CAZyme Information: MGYG000002165_01718

Basic Information

• Species: Zag1 sp900551675
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp900551675
• CAZyme ID: MGYG000002165_01718
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000002165_45|CGC1	39759.37	9.553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002165	1948134	MAG	Denmark	Europe

• Gene Location: Start: 3591; End: 4652 Strand: -

Full Sequence      

MTKKIMLVRLSSLGDVIFNIPLANVLKDNGYEVTWLVSEKGIDIVKDNPAVKRAVLIPLQ
RWKREGFSIKNAIEFFKLVKNLRDEHFDIAIDTQMMLKSMIWMKLCGAKRRICYKHGREL
SQLGGNERIDPAPNPNYTTHAVFQHMQYAKYLGLEGTDRVKFTLPPVSEETKNKVNILLK
NLDKSKPMVVICPATTWRLKHWNKDNWKAVVNGIKDKCSLVFTGTAGDKDLISYIGGDNF
INLAGQTTIKDLIEIFSRAVLVMAPDSGSAHVARATEIPAVISIFCCTPPTSYGPFGNDK
KYFALNGRLKCQPCHTRKCPLPGKDAEQCVNYPEPEEIINIVNNILQNSKHSV

Enzyme Prediction     

No EC number prediction in MGYG000002165_01718.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	77	322	3.6e-45	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.50e-51	3	350	2	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.62e-45	4	344	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.68e-30	76	324	2	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	1.60e-15	4	346	1	333	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	6.98e-12	3	303	6	306	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38472.1	1.60e-205	3	353	2	353
AGB42275.1	4.43e-48	2	343	432	775
AEH45178.1	2.08e-47	4	338	2	323
ADO76416.1	1.00e-45	3	343	7	346
ACL70637.1	3.78e-43	6	346	437	776

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	2.08e-15	3	298	9	294	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002165_01718.