CAZyme Information: MGYG000002219_00293

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_00293
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		41991.94	8.5976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 4739; End: 5902 Strand: -

Full Sequence      

MHRKVLLLAGEESGMLYAERLGALLRAAGCEVRGYGDYGFHTADLAVMGFWPVLRRIFYF
IGVARTMKRAICGWRPDAVVTVDYPGLNLKLAAFAKKRGVPAVHIVCPQVWAWHRNRIPK
VASALSELLCFFPFEPSLFDGTGLKVKFIGHPLVRVVELENADGAAAMSGKTGRDRIVAL
LPGSRIGEIRRILPRLLGAMSILSKRHAEDARAKGRDEPAFRAVIPAANRGAEMEIRRIL
GEASDLPPVEVRLGGARQLLREAHCAAVASGTATLEAALARCPTVLVYAVSPILAWFARR
VITGVRHVGLANIIAEKCGFEPPMPELLQEDFTSDAVADQLEAWLDSAEARADAAARLDA
AMEHLRADGTPLEIAAHEILAALPPSQ

Enzyme Prediction     

No EC number prediction in MGYG000002219_00293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	6	364	3.7e-87	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.49e-93	3	346	2	340	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.36e-85	3	384	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.74e-67	5	330	1	324	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.30e-56	5	341	8	341	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.29e-45	44	336	47	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBG48029.1	2.91e-60	1	347	1	341
QHI67954.1	5.82e-56	1	371	1	363
QDA58158.1	1.00e-55	3	385	6	380
QQL43997.1	1.27e-55	4	381	6	377
CAI09552.1	2.41e-55	1	368	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	8.14e-35	22	331	43	331	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	8.14e-35	22	331	43	331	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5NZG2	4.83e-56	1	368	1	365	Lipid-A-disaccharide synthase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=lpxB PE=3 SV=1
Q21HI5	5.87e-52	3	383	5	380	Lipid-A-disaccharide synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=lpxB PE=3 SV=1
Q3SKM8	2.30e-50	7	376	1	362	Lipid-A-disaccharide synthase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=lpxB PE=3 SV=1
C1F718	6.23e-50	5	351	7	357	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q21WX7	1.33e-49	2	383	8	387	Lipid-A-disaccharide synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) OX=338969 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_00293.