CAZyme Information: MGYG000002219_01136

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_01136
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36167.81	6.8881

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 564; End: 1526 Strand: -

Full Sequence      

MNTIANSSDLRICLMDRTPYAERVECQSRPIAGSHGMWWKFRDPWDASFAHGVTAALKAH
GREAHDPWCIGFFIDNEINWGGTTDLAKWTIQSSADQPAKLAFADWLLKRHGTFAALNAK
WGTEYADRSDFLSSVRLPPSAAKDDLYRFSNLVIDRYFAVTRETVKAFDPQLLYLGCRFA
GWARDEVVAACAKYCDVVSYNIYREKIDDWRLPAKLDAPVLIGEFHFGATDRGPFGTGVR
QAKDQEDRAAKMKGYVETALANPQVVGVHWHQFSDQAATGRFDGEYLQVGLTDVCDTPYP
IMRKALREVGYSLYETRNAR

Enzyme Prediction     

No EC number prediction in MGYG000002219_01136.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	1	314	1.8e-80	0.5130168453292496

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	0.001	62	203	122	262	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP07840.1	1.16e-114	1	318	398	719
AGY53973.1	1.07e-109	1	317	369	684
ASV75458.1	2.20e-98	1	319	364	683
AXP07838.1	1.80e-92	1	320	391	712
QDV65278.1	9.79e-88	1	317	380	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z6P_A	5.45e-56	31	317	462	762	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
4BQ2_A	1.60e-53	29	317	442	746	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	4.20e-53	29	317	442	746	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	1.06e-45	29	317	460	762	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.44e-53	31	317	649	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	1.78e-52	2	316	571	915	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_01136.