CAZyme Information: MGYG000002225_00487

Basic Information

• Species: CAG-873 sp900554265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900554265
• CAZyme ID: MGYG000002225_00487
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	MGYG000002225_53|CGC1	62556.4	4.7789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002225	2013827	MAG	United States	North America

• Gene Location: Start: 598; End: 2316 Strand: +

Full Sequence      

MNKIFTAVLALLAGFGAWAAPAAAESHKADKVVVAYVTSWSDVEVNPEHVTHVNYAFGHV
TDSFDGVRVDNPERLRSIVALKEQAPGLKVVLSVGGWGSGRFSEMAADSARRASFAADCR
RTADEFGLDGIDIDWEYPTSNAAGISCSPDDTANFTLLMRDLRAALGPDALLTMATDASA
KFIDYRATLPYVDFVNVMTYDIANAPKHHAALYSSPNAPDLTVDGSIKAHIAAGVPADRL
VMGMPFYGRGGEKMRGGSFGKIQVPEGCEVRFDSIAMVPLIFNAEGEAILGFDNQVSIAA
KCRYILDNDLHGAMYWDYSDDDDAHTLAYTVAAKIKGRKDMPKLLVLNEGGGQHGPFTAA
AMDWLRRYAAANGLGVTELRNAGPITAEFLKGYDAIIQLDFPPYTWPEAAVVAFEDYIDN
GRGGWIGFHHATLLGEFDGYGLWDWFSKFMGDITFKNYIAPLADGTVRLENTVHPVVEGV
SASFVLPDDEWYTYNRSPRPKVEVLAAVDEDSYTPASDIRMGDHPVIWTNPDKKARNVYF
QFGHSPRLFESPDFTRLFANAIRWTTGANPAE

Enzyme Prediction     

No EC number prediction in MGYG000002225_00487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	31	325	1.2e-68	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	5.01e-93	33	321	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	3.54e-73	32	321	1	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.40e-70	32	321	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	7.60e-65	33	316	1	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
pfam06283	ThuA	2.82e-58	343	565	1	213	Trehalose utilisation. This family consists of several bacterial ThuA like proteins. ThuA appears to be involved in utilisation of trehalose. The thuA and thuB genes form part of the trehalose/sucrose transport operon thuEFGKAB, which is located on the pSymB megaplasmid. The thuA and thuB genes are induced in vitro by trehalose but not by sucrose and the extent of its induction depends on the concentration of trehalose available in the medium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90190.1	7.66e-246	1	567	4	572
ALJ58703.1	2.19e-245	1	567	4	572
QUT62465.1	8.97e-241	31	565	28	564
QQA31016.1	1.15e-240	31	565	35	571
QUT64703.1	4.66e-240	31	565	35	571

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	1.56e-50	32	321	6	329	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
6TSB_AAA	5.24e-49	32	335	37	350	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	8.25e-49	32	335	56	369	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
5GZU_A	6.97e-45	33	342	28	398	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.02e-44	33	342	279	649	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	2.80e-36	21	321	35	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P48827	1.61e-29	51	321	85	383	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
A6N6J0	4.45e-29	7	321	10	390	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P32470	2.11e-27	51	319	85	381	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
Q9W092	5.69e-27	18	349	28	427	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999011	0.000181	0.000186	0.000168	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002225_00487.