CAZyme Information: MGYG000002230_01127

Basic Information

• Species: Ruminococcus sp900545125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900545125
• CAZyme ID: MGYG000002230_01127
• CAZy Family: CBM79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		43267.29	4.8359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002230	2337720	MAG	United States	North America

• Gene Location: Start: 1; End: 1227 Strand: +

Full Sequence      

MGALVGGPTDAGGTYQDSRADYKCNEVACDYNAALVGAAAGLYTVYKTGAPVSSIEGVTK
IYGDGSYQPPVTTTTVSGGNKTTTTTTSKPTVTTTTTVRTVNAGEYEIHPDLSSGSMSEN
FPGWLWSEFNIPDGETAYKVEATISSDSTIGTWNGAFGSTINESDWYQSDNFNEYHDKNT
AVAVWNIDSATSQVINYKYGTLKIGFWWLSSNNYKLDSIKVYTAKSEVPQTTTTTTTRPT
TTTTTTTTSRPTTTTTTTTTTTTTTTTTSRPTTTTTTATTTTTTSKPTTTTTTTTTTTTT
TTTTTTTTTTTTTTTTTTTTTTTSRTTTTTTTTTTTTTTTTTTTTTGNVPGDVNSDGKVS
IADAVLLQRYIIRTAKLTPEQTEAADICKDGVINVFDLVLIKRLIIGL

Enzyme Prediction     

No EC number prediction in MGYG000002230_01127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM79	120	219	2.1e-24	0.9181818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	5.01e-19	350	405	1	56	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam18522	DUF5620	3.31e-18	123	222	8	119	Domain of unknown function (DUF5620). This is a domain of unknown function predicted to be a carbohydrate binding module.
pfam00404	Dockerin_1	2.47e-12	351	405	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14252	Dockerin_like	6.93e-10	351	405	1	56	Dockerin repeat domains and domains resembling dockerin repeats. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
cd14253	Dockerin	1.38e-08	351	403	1	53	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDF00679.1	6.36e-25	102	223	139	267
EWM53237.1	6.66e-20	1	225	392	769
ERJ89368.1	6.85e-19	108	223	81	197
CBL17554.1	3.02e-18	1	58	407	464
CDE33541.1	4.18e-17	1	160	415	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V1L_A	1.53e-10	106	219	6	127	Highresolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V1L_B High resolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V1L_C High resolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1]
4D3L_A	2.84e-10	106	219	6	127	SeMetstructure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4D3L_B SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4D3L_C SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4V1K_A SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1]
2XFG_A	4.36e-07	2	46	420	463	ChainA, ENDOGLUCANASE 1 [Acetivibrio thermocellus]
1G87_A	6.72e-07	2	64	397	457	TheCrystal Structure Of Endoglucanase 9g From Clostridium Cellulolyticum [Ruminiclostridium cellulolyticum],1G87_B The Crystal Structure Of Endoglucanase 9g From Clostridium Cellulolyticum [Ruminiclostridium cellulolyticum],1GA2_A The Crystal Structure Of Endoglucanase 9g From Clostridium Cellulolyticum Complexed With Cellobiose [Ruminiclostridium cellulolyticum],1GA2_B The Crystal Structure Of Endoglucanase 9g From Clostridium Cellulolyticum Complexed With Cellobiose [Ruminiclostridium cellulolyticum],1KFG_A The X-ray Crystal Structure of Cel9G from Clostridium cellulolyticum complexed with a Thio-Oligosaccharide Inhibitor [Ruminiclostridium cellulolyticum],1KFG_B The X-ray Crystal Structure of Cel9G from Clostridium cellulolyticum complexed with a Thio-Oligosaccharide Inhibitor [Ruminiclostridium cellulolyticum]
1K72_A	6.72e-07	2	64	397	457	TheX-ray Crystal Structure Of Cel9G Complexed With cellotriose [Ruminiclostridium cellulolyticum],1K72_B The X-ray Crystal Structure Of Cel9G Complexed With cellotriose [Ruminiclostridium cellulolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02934	2.56e-07	2	64	472	532	Endoglucanase 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celI PE=1 SV=2
P37700	3.93e-06	2	64	432	492	Endoglucanase G OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCG PE=1 SV=2
P26224	5.23e-06	1	52	423	472	Endoglucanase F OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985657	0.014273	0.000049	0.000028	0.000015	0.000028

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002230_01127.