CAZyme Information: MGYG000002235_01792

Basic Information

• Species: Zag111 sp004558955
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp004558955
• CAZyme ID: MGYG000002235_01792
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000002235_19|CGC1	36510.02	6.6945

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002235	1989703	MAG	Peru	South America

• Gene Location: Start: 23436; End: 24410 Strand: +

Full Sequence      

MNLKSKLYQMFILGTDGENYRTALHNGLGGLIFFTKDINSVEQFENLIIEVKTAGIISPF
LSIDQEGGRVERTENLHGDKKYLSAKFAFEKGSEFLKKQTEEIAKELVSFGINLNFAPCI
DTNTNPKNPIIGERAFSSNPDEVIEGEKIVSKAYKNFGIIPCVKHFPGHGDAESDSHLTL
PEINLSLETLEKYHIKPFKFAVQNGAEMVMVAHLHCKCFEKEVIPTSLSKTTIDYLRTNL
KFNGVVISDDMIMKGVSKFGEVEACEMGIRAGLNMFIYRNSTDKTINIIEEIYKKALNDS
ELQNKIEESYNKIISLKKKYGIVK

Enzyme Prediction     

No EC number prediction in MGYG000002235_01792.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	58	276	6.6e-42	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.66e-57	1	324	1	319	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.77e-53	3	316	2	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.05e-36	29	268	27	260	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38577.1	9.29e-167	2	317	3	317
ADU31999.1	1.60e-60	1	322	31	360
CDI50326.1	3.85e-60	1	322	55	384
BAK81023.1	7.26e-60	1	322	50	381
QAA33958.1	3.16e-59	1	322	71	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.58e-43	1	322	11	342	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.06e-42	29	322	87	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.99e-41	29	322	61	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.63e-41	29	322	91	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	6.55e-39	2	320	8	340	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	2.77e-41	29	322	87	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.17e-34	28	308	64	366	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A1SW90	9.23e-34	16	314	14	314	Beta-hexosaminidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=nagZ PE=3 SV=1
B4RQ67	2.84e-33	15	283	21	293	Beta-hexosaminidase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=nagZ PE=3 SV=1
Q5QUZ5	2.23e-32	12	290	8	288	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002235_01792.