CAZyme Information: MGYG000002242_01655

Basic Information

• Species: Treponema_D succinifaciens
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D succinifaciens
• CAZyme ID: MGYG000002242_01655
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		81140.04	5.3266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002242	2466093	MAG	Peru	South America

• Gene Location: Start: 25544; End: 27721 Strand: -

Full Sequence      

MISYSFDNKSLFKGEKRWFPIMGEIHYSRYPDSGWKEALLKMKEGGVDIVSSYVIWIHHE
EIENQFEWTGWRDLRKFVQTIKECGLSMILRIGPWSHAEVRHGGFPDWLLAKCPDARNTN
DEKYFAEVEKFYKAIYEQVKGLLLKDGGPIIGVQIENEFGHCGGLTGDAGEAHMKRLEKM
ARETGFDVPLYTATGWGGAVTAGLLPVMGGYCEAPWDPRITEIEPSGNYVFTYERNDHAI
GCDFGLGEGITFDMTKYPYLTAELGGGLQVTLKRRPIAQPKDIGAMSLAKMGSGCNLLGY
YMYHGGQNPEGKLTTLEENIATGSLNDMSIKNYDFRAPLGEYGLPNGTYGEIKLYSLFAH
DFGEFLASTETDLPESNPITPENFSDLRTSWRYKECEKCGKKRGFVFVNNYQRRRKMAGH
KNVVLASTEKSGADIQFPAIDVADKDFFFLPFNMKVADGLLKTSLATPLCVLNNQRKVYV
FYSAAKPVGSLAEKDSSVCSAKDASVSLYQFEGEVPDCDIVTLSREDALNAHKVSANGKE
YLVVTDSVLFQNNQDGKTELEFEDCKKISFKAFPELEKVPERFSAKKCGGFTVYTFDQDA
AESPKVSCQKISEDEKTAVYKISVESWQNGLDDLFIDIGYAGNCARLYENGKLIDDGIFV
GENYPWSIGLKRYGKNAHDFTLEIDALKKDAPIFIEEWPDFAGQGSLKKVNGIKARAFVK
ISAQL

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	14	354	1.8e-85	0.9739413680781759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	6.75e-53	10	354	1	313	Glycosyl hydrolases family 35.
PLN03059	PLN03059	7.63e-36	3	345	29	327	beta-galactosidase; Provisional
COG1874	GanA	4.84e-18	5	160	2	162	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.25e-06	29	161	6	140	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB15062.1	0.0	1	725	1	726
QOS40615.1	0.0	1	725	1	718
QEH68119.1	6.89e-264	3	699	5	666
ADZ82426.1	5.79e-263	3	699	5	666
ACZ98631.1	2.33e-259	3	711	5	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5F_A	9.64e-31	3	353	7	314	ChainA, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
4E8C_A	3.83e-30	21	383	20	343	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
6IK6_A	5.30e-30	3	353	7	314	ChainA, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]
3THC_A	7.07e-29	1	195	8	199	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	7.83e-29	1	195	32	223	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48980	7.82e-32	3	353	23	330	Beta-galactosidase OS=Solanum lycopersicum OX=4081 PE=1 SV=1
Q10NX8	8.19e-32	5	344	34	329	Beta-galactosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0255100 PE=1 SV=2
Q9SCV0	1.01e-31	5	411	30	379	Beta-galactosidase 12 OS=Arabidopsis thaliana OX=3702 GN=BGAL12 PE=2 SV=1
P48981	1.03e-31	3	345	25	323	Beta-galactosidase OS=Malus domestica OX=3750 PE=1 SV=1
Q9FFN4	3.06e-31	5	353	33	339	Beta-galactosidase 6 OS=Arabidopsis thaliana OX=3702 GN=BGAL6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002242_01655.