CAZyme Information: MGYG000002273_02826

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_02826
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
145	MGYG000002273_17|CGC3	17159.03	7.6298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 105225; End: 105662 Strand: -

Full Sequence      

MIPKIIHYCWFGGKPLPPKAKKYIESWKKFCPDYEIKEWNESNFDVHCCRYVEEAYNAKK
WAFVSDYARFLALYNEGGIYFDTDIEVLKPFDNLLGCGAFFGFGWETLTLPVFGASKALI
VIERFYTTMNKEHLFKQMVLMIYLR

Enzyme Prediction     

No EC number prediction in MGYG000002273_02826.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	95	2e-26	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	5.30e-19	1	95	81	178	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.35e-17	17	96	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	3.65e-07	1	95	45	144	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	7.78e-06	4	43	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.001	51	84	160	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA43512.1	2.89e-53	2	133	6	139
ATP00764.1	2.89e-53	2	133	6	139
ADV44090.1	6.55e-53	1	123	1	123
QSH99417.1	3.61e-50	1	102	1	102
QEK09178.1	4.16e-50	1	102	6	107

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_02826.