CAZyme Information: MGYG000002275_02392

Basic Information

• Species: Paraprevotella sp003477995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp003477995
• CAZyme ID: MGYG000002275_02392
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000002275_27|CGC2	55025.65	7.5196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002275	3751567	Isolate	China	Asia

• Gene Location: Start: 40885; End: 42336 Strand: -

Full Sequence      

MKNYSLLLALSLLLATGTARAARPDVVPTPGQKAMIDRKYGMFLHFGMNTYLNAEWSDGS
AAASVYAPPADIAEKAAQWVRHAKRAGMRSIVLTTKHHDGFCLWDSKYTDYDVANPQVRH
KADIVRAVSDACKKEGIAFSIYYSLWDRHEPLYRDPDPRKYIEFMKKQLGELMTQYGPVA
ELWFDGAWDRKVDQWYLPEVYDFVKKLQPQCQISTNWTIGKRPVDMKAGDPIVYFPSDFR
LWDPFLPVQDDPKIYTYQGQEYYLPYECTQTISVLGNWFSHPEDTTVRELEELEEIFHGS
TANDNCLLLNIPPDTHGEQNPLAIRRIEELASLLGIQNGGDFPKKPKTPSSLTRNATATA
TGIHKDDALHNGPLYAVDSDVSTAWTGDSLSVLQIRLARKVAFKQLFLIIGKGSIGEYAL
EYLDGKTWKTLHQDRIDPATQPQSFMGYGFIDLKFDRKIRARDLRLRVLQSNGRPSVYSL
RLR

Enzyme Prediction     

No EC number prediction in MGYG000002275_02392.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	37	334	7e-66	0.838150289017341

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	3.59e-48	37	339	24	332	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.28e-45	37	339	25	334	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	1.72e-42	28	346	11	324	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	6.74e-06	370	482	11	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam14871	GHL6	4.92e-05	76	178	2	128	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24262.1	1.15e-244	26	483	32	490
QCQ30775.1	2.06e-233	18	483	24	490
QTO26591.1	8.35e-233	18	483	24	490
QCQ35194.1	8.35e-233	18	483	24	490
QRY59801.1	4.51e-121	1	480	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	3.96e-49	27	321	38	339	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	2.46e-47	26	479	8	450	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	6.10e-46	26	331	30	349	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	3.39e-36	25	389	16	386	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	4.25e-35	25	389	16	386	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.02e-48	42	385	52	381	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.45e-42	6	431	11	435	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	4.79e-18	37	346	36	354	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
P10901	5.93e-16	37	376	39	388	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q9VTJ4	6.50e-14	37	346	52	372	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999057	0.000214	0.000172	0.000173	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002275_02392.