CAZyme Information: MGYG000002281_01327

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_01327
• CAZy Family: GH16
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	MGYG000002281_4|CGC4	57245.05	7.1734

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 218997; End: 220538 Strand: +

Full Sequence      

MKNHVMKTNRAFKEFCVLGGLAYSVCGVAQERPNIIVFLVDDMGLMDTSVPFLADESGQP
VRHPLNDWYHTPNMERLAKQGICFSTFYAQSVSSPSRASIMTGQNATRHGVTNWINAESN
NRTPFGPPEWNWKGLRKDMPTMPRVLQQAGYKTIHVGKAHFGCMGSEGENPLNIGFDVNI
AGSGIGHPGSYYGEWGYGSIKGEKARAVPDLEKYHGTDTFLSEALTVEANREIAAAVKEK
RPFYLNMAHYAVHSPFQADKRFLSRYTDPDKSDQAKAFATLIEGMDKSLGDVMDQLEKLG
IAENTLIFFLGDNGGDAPLGDERGYGSSAPLRGKKGTEFEGGMRVPFIVGWAKPEKKSAV
QKHLPIEAGGIQMQLGTIMDIYPTVLSVAGCEVPQNYVIDGFDLKRQLSGKADRKRPESF
LMHFPHAHRGSYFTTYRLGDWKLIYYYSPETPKQPKALLYNLKDDPEERKELSSTHPDKC
REMIQEMAAQLEKEGALYPVDKQGNELKPFVCF

Enzyme Prediction     

No EC number prediction in MGYG000002281_01327.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16144	ARS_like	2.84e-160	33	489	1	420	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	1.31e-95	32	473	1	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16146	ARS_like	1.19e-88	33	489	1	403	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16029	4-S	1.72e-79	33	473	1	393	N-acetylgalactosamine 4-sulfatase, also called arylsulftase B. Sulfatases catalyze the hydrolysis of sulfuric acid esters from a wide variety of substrates. N-acetylgalactosamine 4-sulfatase catalyzes the removal of the sulfate ester group from position 4 of an N-acetylgalactosamine sugar at the non-reducing terminus of the polysaccharide in the degradative pathways of the glycosaminoglycans dermatan sulfate and chondroitin-4-sulfate. N-acetylgalactosamine 4-sulfatase is a lysosomal enzyme.
cd16143	ARS_like	8.83e-79	33	473	1	395	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89376.1	5.00e-106	28	510	19	496
ALJ59588.1	3.82e-105	28	510	19	496
EAR02039.1	4.38e-100	28	510	24	507
AKJ65363.1	2.61e-57	31	499	25	452
QDT74124.1	1.04e-41	17	491	21	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6USS_A	5.81e-106	27	499	28	502	ChainA, Sulfatase [Bacteroides fragilis CAG:558],6USS_B Chain B, Sulfatase [Bacteroides fragilis CAG:558]
6UST_A	8.52e-46	32	478	4	440	ChainA, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_B Chain B, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_C Chain C, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_D Chain D, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi]
6PSM_A	1.60e-45	31	487	23	433	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]
6PRM_A	8.13e-45	31	487	23	433	Crystalstructure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]
6B0K_A	1.81e-40	31	487	1	415	Crystalstructure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas],6B0K_B Crystal structure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas],6B0K_C Crystal structure of Ps i-CgsB C78S in complex with k-carrapentaose [Pseudoalteromonas]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q32KH5	1.35e-41	17	442	15	399	N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris OX=9615 GN=GALNS PE=2 SV=1
Q571E4	2.48e-41	17	442	13	397	N-acetylgalactosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Galns PE=1 SV=2
Q32KJ6	1.78e-40	17	404	17	370	N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus OX=10116 GN=Galns PE=1 SV=1
Q8WNQ7	1.07e-38	17	442	15	399	N-acetylgalactosamine-6-sulfatase OS=Sus scrofa OX=9823 GN=GALNS PE=2 SV=1
P34059	2.01e-38	29	404	27	368	N-acetylgalactosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GALNS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.680437	0.242086	0.072754	0.002282	0.001067	0.001377

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_01327.