CAZyme Information: MGYG000002290_01604

Basic Information

• Species: Sellimonas sp002161525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Sellimonas; Sellimonas sp002161525
• CAZyme ID: MGYG000002290_01604
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757	MGYG000002290_9|CGC1	87439.25	8.269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002290	3837069	Isolate	China	Asia

• Gene Location: Start: 27034; End: 29307 Strand: -

Full Sequence      

MIPRKEFLMETVPYFLQNKEKVGLIQTPQSFYNQDLFQFNLYSERDIPNEQDFFSREINI
LRNSSNSAAYTGSNTVISRKALEEIGGFPYGTITEDFETSIRLQKAGYITYATSKVLASG
LSTTTVKSMIRQRIRWARGVIQSIRNTNAVFTRKLSLAGNLSYLNAYFYWWSFFNRMIFI
LAPILFALFDFQLARCGFWELMIFWLPSHLCSSMSMRYLSTNIRNMRWSQIIDTILAPYL
IFPVLLESIGIQQKTFKVTEKRKTSNKTTSFWYILPHGALIVLSIAAIIRYVKGKYGMAL
LFSSVILFWLLYNLIALTYAVFFMLGRDSKRKFERIMAKENVKIYVHGNWQEGETFDVSE
NGIAFLLDKYIPMEKGEEFLIVVQGNDYHADLKAEFVYVKQTPEAFYYAATVTPKEETSF
QNWMQIIHDREHSLPKEMDPWMTVCMTVCLSLIPYVVWNLYVRCRFSGIEQKFQLAFGKQ
ESLAVSKEQYGQITEEFVKAAFSISNRAILAFFLCNIAAVLAVLFVRIFLKKQWKLGRVL
IVVDLMAILYHIGILGLYLFSMPEEEAVRLAGFDRYACSIMVLVEGLLFMQATIDMEHSF
AVRIEGNGTYRAFSSPAAKRRYQYMVLATMMIGVNFLYSEINGLLYIQSNYSQSLAGRME
TLAGDRWQEEEDQRKYFVAASDREGQVSNGEVYYVSRYFLNAPNVEVTERLDAGNMDEIK
KEYDVLIILDESAVHSGTADVKNAVWNRSGVYPLKDN

Enzyme Prediction     

No EC number prediction in MGYG000002290_01604.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	184	1.8e-17	0.8730964467005076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11498	bcsA	2.01e-49	2	321	351	673	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	9.12e-49	1	142	95	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	3.15e-25	2	318	149	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	5.29e-22	4	145	98	233	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
pfam13632	Glyco_trans_2_3	3.50e-20	6	193	14	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMF90406.1	1.12e-176	1	443	173	638
APO43063.1	3.09e-173	1	443	184	649
QOS81892.1	4.41e-173	1	443	173	638
QZN77042.1	6.22e-173	1	443	173	638
QLG37677.1	8.78e-173	1	443	173	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	5.47e-38	2	384	364	750	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	2.17e-32	2	367	238	607	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.75e-32	2	367	250	619	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.76e-32	2	367	251	620	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	2.81e-40	2	400	250	652	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q93IN2	2.23e-39	2	384	364	750	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	5.28e-39	2	384	364	750	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q8X5L7	1.23e-37	2	384	364	750	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	2.89e-37	2	384	364	750	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
167	189
196	218
228	250
270	289
304	326
440	462
508	530
539	561
624	646