CAZyme Information: MGYG000002305_01125

Basic Information

• Species: Leminorella grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leminorella; Leminorella grimontii
• CAZyme ID: MGYG000002305_01125
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824	MGYG000002305_2|CGC3	94408.83	6.6826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002305	4219592	Isolate	not provided	not provided

• Gene Location: Start: 280383; End: 282857 Strand: +

Full Sequence      

MKAISTENRRSLPFVSVVTPTFNRAEFLPYLLYMYRYQDYPAECRELVILDDSPKSHQDI
INTLTQGRPESFNIRYIHHPERLALGKKRNMLNELAQGEYILCMDDDDYYPADKISYTIE
MMQKHGATISGSDQIPIWYSHINRLFKTHSFGNQHILNGTFCYHRNYLKKHRYDDDCNLG
EELAFTNGFTVSPLQLPGERTIMCVSHSHNTFDKDFVLGNSESLDAALDDVISDAMLKNW
YQSLHNATHSRPIEWGFIDKVVVINLDRRTDRWRQISEELAQLQAPADKIVRLSACEDDD
GHAGRRRSHLKALKMAQREGWKNYLLLEDDAVLLKQEKYVNALNGLSNSLSALGWQAVIL
GGQINRGRPLNSLPGIVHAADCQRVCAYLVNAPYYATLAQQMTLDPSATLEEQWRPLLEQ
GKWLACSPSLSYQRAGYSDIEKKESDNVRFYFNRVNKNHRTEKLQASQQPIANLLGEKIG
FYIGNPFHYQLYRTVLPVLQAAGYACDLLLDDAQPPERLDGIKRLLASLENRELSGSPLS
EVKNRRQRYACLVSPFYTPKIKGLAEVNVRAMPTQTNAVWNFAWWNLFYQRQLCYSSYDR
RALSINDSAVIVGDPRFDDWHNDRVDLSALSSLRLDERKPTLLYAPSLDARASMLQWAEQ
LEPLSQEFNLVTLLHNDDDLRARSPLASFKRLYKRAVNDDALLLPLLKKADVVLSDDDAR
LFDALHAGKRAIVLQAQEQSTIQTADDASRELRAHLPAARDVAELRQRLAESSGADMEDL
RRRYCDAYMDGRAGERAAQEIIRALEENKEEHVLLESIKSRLFN

Enzyme Prediction     

No EC number prediction in MGYG000002305_01125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	16	130	3.8e-21	0.6529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.59e-18	16	180	1	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.29e-14	17	151	1	124	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02525	Succinoglycan_BP_ExoA	2.33e-11	14	131	1	115	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG0463	WcaA	2.41e-10	11	172	1	160	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06532	Glyco_transf_25	1.70e-08	260	333	1	95	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCA19732.1	0.0	10	824	22	853
BCU56458.1	0.0	10	823	24	853
QMR46619.1	0.0	10	824	22	853
QKE21591.1	0.0	10	824	22	853
AHY12006.1	0.0	7	824	19	853

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQ09	5.23e-27	12	224	2	218	Uncharacterized glycosyltransferase L193 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L193 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002305_01125.