CAZyme Information: MGYG000002310_08957

Basic Information

• Species: Microvirga massiliensis
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Microvirga; Microvirga massiliensis
• CAZyme ID: MGYG000002310_08957
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		35747.41	11.048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002310	8892798	Isolate	not provided	not provided

• Gene Location: Start: 5506; End: 6492 Strand: -

Full Sequence      

MMHTARRSPLFDLFVAPNRILRSARDGLSPGLPGIRADFCVAESNDDVIPIVRRLMAAHP
HVPSRPLIGDVHVSANPKLNNCIKGWDAARHEWIVLADSNVLMPPDYIHRLIAAWRPDTG
LVCSTPIGACPRGFWAEVECAFLNTLQARWQYAGEALGLGFAQGKSMLWHRPVLDRNGGI
RALAAEIAEDAAATKLVRSAGRRVHLVGIPFDQPLGRRTLRDVWGHQARWVRLRRVTFPL
SFAPELLTTAVIPLGFGIWAAQAGQGAMAAAVMSAVVLWYGAEPVLAAGKGWHTSPGSRL
PSWSVTPLSRSCGLQRGSIRRRSGAEIG

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT21	39	234	2.8e-59	0.8497854077253219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02520	Glucosylceramide_synthase	2.08e-52	39	234	35	196	Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis. UDP-glucose:N-acylsphingosine D-glucosyltransferase (glucosylceramide synthase or ceramide glucosyltransferase) catalyzes the first glycosylation step of glycosphingolipid synthesis. Its product, glucosylceramide, serves as the core of more than 300 glycosphingolipids (GSL). GSLs are a group of membrane components that have the lipid portion embedded in the outer plasma membrane leaflet and the sugar chains extended to the outer environment. Several lines of evidence suggest the importance of GSLs in various cellular processes such as differentiation, adhesion, proliferation, and cell-cell recognition. In pathogenic fungus Cryptococcus neoformans, glucosylceramide serves as an antigen that elicits an antibody response in patients and it is essential for fungal growth in host extracellular environment.
pfam13506	Glyco_transf_21	9.24e-52	60	232	1	174	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.
TIGR03472	HpnI	1.38e-25	33	259	69	301	hopanoid biosynthesis associated glycosyl transferase protein HpnI. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The member of this clade from Acidithiobacillus ferrooxidans ATCC 23270 (AFE_0974) is found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. Similarly, in Ralstonia eutropha JMP134 (Reut_B4902) this gene is adjacent to HpnAB, IspH and HpnH (TIGR03470), although SHC itself is elsewhere in the genome. Notably, this gene (here named HpnI) and three others form a conserved set (HpnIJKL) which occur in a subset of all genomes containing the SHC enzyme. This relationship was discerned using the method of partial phylogenetic profiling. This group includes Zymomonas mobilis, the organism where the initial hopanoid biosynthesis locus was described consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and another radical SAM enzyme (ZMO0874), HpnH. Although discontinuous in Z. mobilis, we continue the gene symbol sequence with HpnIJKL. Hopanoids are known to feature polar glycosyl head groups in many organisms.
COG1215	BcsA	1.10e-16	39	238	89	288	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd04192	GT_2_like_e	2.64e-04	43	137	37	130	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL62097.1	1.31e-133	33	295	69	329
AWN44908.1	1.49e-132	33	296	79	340
AWN44276.1	1.49e-132	33	296	79	340
AWN44934.1	4.03e-124	33	296	70	332
QJI87404.1	8.81e-124	39	296	72	329

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q16739	1.38e-23	40	262	86	308	Ceramide glucosyltransferase OS=Homo sapiens OX=9606 GN=UGCG PE=1 SV=1
O88693	3.23e-22	40	262	86	308	Ceramide glucosyltransferase OS=Mus musculus OX=10090 GN=Ugcg PE=1 SV=1
Q5U4S8	1.13e-21	40	262	86	308	Ceramide glucosyltransferase-B OS=Xenopus laevis OX=8355 GN=ugcg-b PE=2 SV=1
Q9R0E0	1.13e-21	40	262	86	308	Ceramide glucosyltransferase OS=Rattus norvegicus OX=10116 GN=Ugcg PE=1 SV=1
Q5BL38	2.12e-21	40	262	86	308	Ceramide glucosyltransferase OS=Xenopus tropicalis OX=8364 GN=ugcg PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002310_08957.