CAZyme Information: MGYG000002343_03850

Basic Information

• Species: Acinetobacter courvalinii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter courvalinii
• CAZyme ID: MGYG000002343_03850
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1086	MGYG000002343_13|CGC1	116796.68	9.9129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002343	4074146	Isolate	United States	North America

• Gene Location: Start: 25278; End: 28538 Strand: +

Full Sequence      

MYKSGKLMSQTSATSLFKITVLTSALAALGITTGCSSTPQSGKTSSSKQVGSGYLDASSL
DSLEDLLSATDMRAVEGDRLLVLKHGDVWKRMTVGFKMDLNHWDSRIEAQRSWFISRQPY
LDRLSARASRYLYHTVKEAERRGMPTELALLPIIESSYDPAATSSAAAAGLWQFIPSTGR
IYGLQQTSLYDGRRDVVESTRAAYEFFGSLYNQFGSWELALAAYNAGPGRIQQAINRNRA
AGLPTDYWSLKLPQETMNYVPRFLAVAQIIKNPGAYGVSLPPIANRPHFREVSLSAPLEL
NQIASITGLSRAELYALNPGYRGEMVDPMSPMRILIPADLSPSIDAKLRSGKSGSGGFWA
SNKTPPPMANSSSSTSTTIRTTTSTPQNVSPSTKTPPNLTASNSTRTTTPTIPKSKVNTP
RGSDALASFAAAADVPSAPRIPVAITPAANVKPVKTEPPISLKEREQITAAIKEEGKKET
VAQALEPQATQAERDQVVAEIKAIAPKGTEIVDPFDGKIKLTAIQTSQSVADEKGQEVSK
GFAYPKNLLEDSATANSEDAKRNQGKPYIKTDTDVVVTAPKGKRSTYVVQPGDTLAVIAQ
KNGVNWRDIAQWNQIDPNGTLFVGASLYLYNAKPQAEAPKAAEKPDSYVVQSGDSLTNLA
SRFDLSLKQLADYNNLSVTDGLFVGQRLTLLEPKNNARTTQQSARNNESKASATAKVATK
SYTVKRGEYLKLIADRYALSNQELASLTSGLTAGSSLFVGQKINVPLHEVSQTEEAAEPT
KNTVKYENVTASTSYKTENYTVQRGDTLSSIATKSKISLSELAELNNLKANSGVRLGQSL
KIPAGSTVPDQYVVQSGDSLNAIAAKYNLQLSYVADLNGLERTAGVRVGQRLKLTGDVPA
KTATGSNTKTREDSTPEVYTVKSGDTLGNIASRYNLQLDYVAGLNGLTRSSNVRIGQRLK
LTGDAPKAESASVDTAKTAPKAAAPGRNTERYSVKAGESLNSIANRFGMSGRELADLNNL
KANTSLQRGQNILVPKTIAEYKVKRGDTLIGLASRYGMETNALAEMNDLTPSTQLRIGDV
IKVPSL

Enzyme Prediction     

No EC number prediction in MGYG000002343_03850.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	137	272	3.9e-23	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	2.93e-77	33	337	14	311	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	3.20e-57	140	268	2	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK06347	PRK06347	2.72e-26	394	961	54	591	1,4-beta-N-acetylmuramoylhydrolase.
pfam01464	SLT	2.45e-21	137	242	3	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK06347	PRK06347	2.85e-18	780	1073	315	582	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHH96201.1	0.0	1	1039	1	1037
QHH94591.1	0.0	1	1038	1	1036
AVZ85343.1	0.0	1	1038	1	1048
AZM38716.1	0.0	1	1038	1	1048
APU49276.1	0.0	1	1040	1	1035

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	1.92e-09	800	964	44	219	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
6FBT_A	4.19e-07	115	269	432	591	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	4.31e-07	115	269	461	620	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	9.56e-07	115	269	432	591	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	9.57e-07	115	269	433	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	8.42e-62	78	352	49	323	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	8.42e-62	78	352	49	323	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P32820	1.95e-27	125	287	19	178	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P37710	9.04e-23	582	961	358	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
O07532	6.06e-20	650	965	31	354	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.008471	0.991239	0.000036	0.000010	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002343_03850.