CAZyme Information: MGYG000002372_00893

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_00893
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920		103912.65	4.3753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 1050954; End: 1053716 Strand: +

Full Sequence      

MWTGNDVIPPNGVSLEDAKKVSNVYNRKMMLWWNYPVNDYKEDKMALGPIYDLDRNLDEE
VSGFIVNPMRFSDASKISTLTGADYGWNSVSYEAEKSWDKAIEIIAGEMKEEFKIFANHS
TRLDTGRPDSPEIKNTIDSLWEKWEAGSDISLELSNLQNEFSKMVQVPNKLRSNLENKAL
LNQLDSHLSKFEIYGNAGLKPIEILQDILNKDMSEFWSDNFEGIKLLRNLDGIKATIANN
VVDPFIRKVHEVGNEYFNKETTVLEEKEYSYTSIGNIVDHKYSEWFISEETHVPNYMFDD
KDNTGFWSAAPVQKDEFIGFDLGEAEEIKDIYLLMGRNNNDTDVLTNGVIEYSLDGENWT
ELEVNKGERELLVETGIKARFIRYRALSDSENKLYVRDFKVNTGKSKEKLIGDVEVKDSN
INKSSEGENEIISASNINKISFEEGDSIGLAINDVKNVIGFEVLGDVESNKFVLESSFDN
IEWEEVYNGTSFNDETPLVGKFFRIRAKEKTEANINEIKISLEGYSKGIVSTNRRISSNV
NIHPDFVADNDYGTSFVCSDTIKKGDFVQLDLGVEKKIRDISLVQGPGGDYMDGDIEYSL
DGENWTKLGVVEGTDTLIKDLDVKARYVRVISTGYKDRWSRVREFTVNKTVKEFETKATS
EGTYTDRSENIRDNNLNSAYIPEGEIKSGDYLLRRIFNERLISKVTVAQSTDNLSGAKVI
GKTVNGETLDLGVVDKGLNELVLKNPRQLVSVKLVWEKDAGKVEIFEVKPTFVSLDSIIE
DVKNEIQRGKDVLVEHKDKENEERTQLEEALKNIENLLNNKASDDEIVRAYEDLTNKINN
FIDSEPNKEEENKPSKPEGGENGSEGEEDKEDSEDKNENEDNKDENGNLPNTGSPLGAGE
LMLVGAALATLGGVTIKKKK

Enzyme Prediction     

No EC number prediction in MGYG000002372_00893.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	1	117	7.7e-36	0.39322033898305087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	9.12e-45	1	116	178	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	1.18e-13	289	392	9	118	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam00754	F5_F8_type_C	1.39e-10	543	645	13	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.26e-07	567	635	47	131	Substituted updates: Jan 31, 2002
cd00057	FA58C	2.68e-04	302	383	32	125	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAB80587.1	0.0	1	920	378	1297
AXH51976.1	0.0	1	920	378	1297
SQI03922.1	0.0	1	920	378	1297
AWS25521.1	0.0	1	920	378	1297
ASY51023.1	0.0	1	920	378	1297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV5_A	4.00e-170	1	251	371	621	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2V5D_A	4.32e-51	1	397	334	710	Structureof a Family 84 Glycoside Hydrolase and a Family 32 Carbohydrate-Binding Module in Tandem from Clostridium perfringens. [Clostridium perfringens]
2CBI_A	5.21e-48	1	248	334	585	Structureof the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBI_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBJ_A Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2CBJ_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2V5C_A Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2V5C_B Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2VUR_A Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2VUR_B Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2X0Y_A Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens],2X0Y_B Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens]
4ZXL_A	1.86e-47	1	248	326	577	CpOGAD298N in complex with Drosophila HCF -derived Thr-O-GlcNAc peptide [Clostridium perfringens ATCC 13124]
5OXD_A	2.21e-47	1	248	336	587	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XL08	6.44e-50	1	542	364	904	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	1.14e-49	1	461	364	808	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q89ZI2	1.27e-32	1	399	329	730	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
P26831	2.57e-28	27	772	401	1355	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002372_00893.