CAZyme Information: MGYG000002372_02239

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_02239
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
932		103854.1	4.3675

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 2452305; End: 2455103 Strand: -

Full Sequence      

MKVRAIKSFLITTMAMTFLVSMGQGSILTKANTINNMKYVTEAFGAIPTEEQVSYQKEEL
TAFIHFGVNTFTGREWGDGTENPDIFNPTNLDADQWVKTLADAGFGRVILTAKHHDGFCL
WDSAYTKHDVASSPWKNGKGDVVKEVSEACAKYNIKFGVYLSPWDQNSEHYGEGNGGDYN
EFYMNQLRELLTNYGPIAEVWMDGAKGSNVKQEYNFEEWFALIKELQPECLIFSPQGPDI
RWIGNEKGYAGEPCWSTIDIEKMKERENPTYLNNGEEGGPDWVVGESDVSIRPGWFYHES
QDNEVKSLEKMMDIYFKSIGRNSVLLLNVPPNKEGKLHENDVNRLKEFGETIKELFNDDL
ALNKEVIVDGFANRDETYGANKIVDGDYDTYWAPDNSSKTGTIEIDLGESKEFDVISLQE
YIPLGQRVSSFNVEVLQGENWNKVYEGKTIGYKRLVRIAPTKGEKIRINITGSLEVPLIN
NVGVYKQPTSIELPSGPPAGLKVLNDDNKGNELEQFNFSDGWVYETIHGENDLGGDAHYT
SKTNATVNIKFNGTKFFLSGTKDSGHGIMEISIDGENPVEVDLYSPNRKSKEIVFESEDL
SDGEHEVTVKCTGRKNSSSRGTAAHIDGAYVLDNGGKGMVEFEKVGYEVSENIGTATFKV
IRKGGSNGKLEVNYDTLAGTALNGVDYQTWSGTLAFNEGETEKTFDITIIDDKEKEEPKE
FYLKLSDPIGGILGFNSRATVTINDDEQIKIETKDTGDGLHQFNFSGGWNKETDGVWTNN
MNSTFSIKFRGKQISLIGANDPNHGIYEVSIDGGEFVEVDAYAESRVTNQVIYESEVLTS
GEHILNFRLKGENSHGGRADGQLNYALVDTSEDNLVEPEMPTTDLNKDGKVDIGDLSLAS
KHYGENIKEYDINGDGVIDEFELNSIMNDILK

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	48	353	3.6e-86	0.8670520231213873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	9.49e-87	45	485	8	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	8.76e-46	86	350	79	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.40e-41	63	350	31	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
smart00237	Calx_beta	3.73e-22	638	726	2	90	Domains in Na-Ca exchangers and integrin-beta4. Domain in Na-Ca exchangers and integrin subunit beta4 (and some cyanobacterial proteins)
pfam03160	Calx-beta	1.13e-21	638	726	2	91	Calx-beta domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOY54644.1	0.0	1	932	1	932
AMN33375.1	0.0	1	932	1	932
ALG49483.1	0.0	1	932	1	932
ATD48000.1	0.0	1	932	1	932
AQW27426.1	0.0	1	932	1	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ORG_A	1.95e-142	45	488	8	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	2.92e-141	45	488	8	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	3.02e-141	45	488	8	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
4ZRX_A	6.86e-134	40	485	24	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
6TR3_A	7.21e-124	47	522	27	541	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	2.37e-133	47	491	39	482	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	3.58e-132	47	485	37	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q9BTY2	3.22e-12	55	353	78	361	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q6AYS4	1.68e-11	55	353	70	353	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q5RFI5	2.28e-11	55	353	76	359	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005687	0.933884	0.059464	0.000370	0.000287	0.000263

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002372_02239.