CAZyme Information: MGYG000002379_01106

Basic Information

• Species: Lactobacillus acidophilus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus acidophilus
• CAZyme ID: MGYG000002379_01106
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		43080.29	9.9029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002379	2009479	Isolate	not provided	not provided

• Gene Location: Start: 16590; End: 17714 Strand: -

Full Sequence      

MKRLKLVPLTFILIIVIFTAIMAYVRLDNSHQLKQDFYRQWQKYYVVKINEKESYINTTP
NSNKYTALSEGQGYGMYISALAAQNGFGDKATFERLNNFYLKHRETINKRKTALMSWREV
EENGKWQVDKNSATDGDLFIAEALLLASKVYKDIYYQDEAVKILQDILRYEYNAKTRTLT
VGNWANKNSKYYDLMRTSDVMPEFFDSFYKATGDDRWLTIKRTMLERLYQLSRQHKTGLV
PDFAWVSATNAQPVKANTVATKDDGNFSANACRVPMMLANSNNKVAKKIENRMLKFFSKQ
NVVTAGYTLSGKAINNYVSASFSAPIFCAVSFNRKEGYDNLFMSQQYIFAKRLPQNNYYD
AALTTIAALDAAKM

Enzyme Prediction     

No EC number prediction in MGYG000002379_01106.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	37	369	1.1e-72	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3405	BcsZ	1.64e-22	12	369	2	342	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	3.76e-22	38	325	8	277	Glycosyl hydrolases family 8.
PRK11097	PRK11097	6.51e-14	69	364	54	345	cellulase.
pfam05147	LANC_like	4.66e-05	60	230	154	303	Lanthionine synthetase C-like protein. Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs. Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains. This region contains seven internal repeats.
cd04793	LanC	0.001	80	174	184	283	Cyclases involved in the biosynthesis of lantibiotics. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthinoine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as precursor peptides and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans) in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. Also contains SpaC (the cyclase involved in the biosynthesis of subtilin), NisC, and homologs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN46048.1	2.56e-272	1	374	1	374
AAV42008.1	2.56e-272	1	374	1	374
ASX14127.1	2.56e-272	1	374	1	374
AVW87761.1	2.56e-272	1	374	1	374
AGK93337.1	2.56e-272	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	1.96e-28	27	325	58	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.58e-20	24	329	21	339	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.73e-20	24	329	27	345	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	3.06e-15	56	279	22	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	1.49e-09	69	276	48	243	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	5.27e-27	27	325	58	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	8.66e-22	24	335	77	401	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37696	4.47e-11	69	276	56	251	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
P37651	2.24e-08	41	246	28	222	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8X5L9	5.31e-08	41	246	28	222	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.729674	0.248555	0.013892	0.000888	0.000542	0.006451

TMHMM  Annotations     

start	end
7	25