CAZyme Information: MGYG000002382_03408

Basic Information

• Species: Stenotrophomonas maltophilia_AK
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AK
• CAZyme ID: MGYG000002382_03408
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	MGYG000002382_131|CGC1	28019.15	9.7022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002382	4489830	Isolate	not provided	not provided

• Gene Location: Start: 64199; End: 64975 Strand: +

Full Sequence      

MFHRPLLLALVLLPILWPGMAAARTVYRCVQGNTVSLATAPEPGSRCTPKEIDDNAIQAP
NLWGNMGVFSGVLYEREQDGVLVYSTRNLPGSRVFLKFTVATPPGEPAHEGLGKVGKPQL
AQHARQFKAASKATGVDDAWLRAIAHAESNFDALAVSSKGAQGVMQLMPETAQEYGVRDP
FSPQQSIEGGARYMRALLRRYNGDRPLAAAAYNAGIGAVTRYKGVPPYAETLAYVDKVMA
LYARYREAMGIRTEVPAR

Enzyme Prediction     

No EC number prediction in MGYG000002382_03408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	139	246	1.5e-31	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.64e-44	139	243	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.61e-37	123	246	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.55e-36	130	242	11	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	3.89e-32	127	246	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.51e-28	127	224	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA89333.1	2.60e-184	1	258	1	258
QCZ95930.1	2.60e-184	1	258	1	258
QNA94628.1	2.60e-184	1	258	1	258
QGL78911.1	2.91e-181	1	258	1	258
QNG79981.1	2.91e-181	1	258	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.69e-12	136	250	429	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.71e-12	136	250	433	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.74e-12	136	250	439	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.76e-12	136	250	443	574	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	6.79e-12	136	250	449	580	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.42e-32	127	242	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	9.53e-24	105	244	1409	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	9.53e-24	105	244	1409	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
Q1QZB1	1.38e-11	119	228	286	407	Membrane-bound lytic murein transglycosylase F OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=mltF PE=3 SV=1
Q4KHS7	1.11e-10	112	217	270	389	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000202	0.999242	0.000142	0.000138	0.000126	0.000122

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002382_03408.