CAZyme Information: MGYG000002390_01444

Basic Information

• Species: Ligilactobacillus agilis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus agilis
• CAZyme ID: MGYG000002390_01444
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000002390_16|CGC4	94238.87	7.152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002390	2133539	Isolate	not provided	not provided

• Gene Location: Start: 117032; End: 119467 Strand: +

Full Sequence      

MGAINVWNMVKFFTLGDLMLPLENNEIRFLVASNDDVRVIYNDNRLNLMQGDFLILNSKS
TRAVEQTKDAILISLFVDGSEDSRKSYGDNIANKIEGCSAYKTSEFDKQLQTCLLNLIRT
RTNGEDYIEADVYKNYYEIISLVYKHYIVSDSKEQVQVEKFGNQAKKAYEIRDYVQQNYK
KNITLDQVAEHFYLSTPYLSRLFKKIFEISFHKYITNLRIDGALSELINTEKTVTDITFD
NGFPNVGSLNTAFKRKYGTTPGNYRLKYKEKKEHEKNAREFVEPTEQMGQLSQLKKTPQS
TNSLKVVTDLFTNKWQHLATSWKKVINIGPAGLVGLNVMEKQISQIQAEFKFEYGRIFAL
FTDEMLMVNSSNQDQFSFSKIDDALEVLLQNGLKPMIELGKKRLNVHMNYSERIYNSASY
DFISQNNFSWPAFLESFLKHCIARWGYDEVKEWMFELWLPSQTVSTSGKEFFISEKDLNH
YLSMFAATKRSIKKVIPEAKVGGCGLSIDIDSNVTERIINKWQEKVLPDFFSIYLYPQSF
KHPQDEQVIQNEIFTDVSIMKNMIDDTKRTMRDTKFVDIPLYVTEWNISISDRNYIHDSL
FKADYIIETVLGCANKVEMFGYWQLSDLYGTFGSTPQLLHGGSGLITKDDIPKASFFSFV
FLNKLKGNVLYRNDNIIITAEGYKRINILIYNKKNFNSIYHLKKENLLEVARIENAFEDI
LPLKQIIRLKDIQSGTYRVKKIQLDKKNGDILSHWIEWDQALNLSKEDISYLKQVCRPKL
LVQSVKVKDFMDLEVNLDANAVIFYELLHEL

Enzyme Prediction     

No EC number prediction in MGYG000002390_01444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	317	757	2.9e-63	0.9721577726218097

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	2.31e-46	322	807	18	487	Glycosyl hydrolases family 39.
COG3664	XynB	5.08e-44	341	807	8	424	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	2.55e-26	170	265	24	119	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	3.47e-26	182	265	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	1.01e-20	188	265	1	79	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCX34311.1	1.44e-122	27	810	34	831
QSF46208.1	8.71e-113	26	788	34	805
AQR96769.1	2.57e-111	24	797	26	788
AGF58080.1	7.68e-109	48	797	50	788
AQR96727.1	7.37e-104	24	787	22	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PX8_A	3.62e-39	322	807	18	479	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
2BFG_A	1.70e-38	307	807	3	480	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
2BS9_A	1.70e-38	307	807	3	480	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4M29_A	2.20e-38	340	807	44	496	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	4.01e-38	340	807	44	496	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30360	1.47e-38	304	807	2	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	2.19e-37	322	807	18	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q9ZFM2	1.53e-35	307	692	3	387	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P23552	9.58e-31	322	772	24	448	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q5HJR8	5.90e-29	167	802	156	734	Uncharacterized HTH-type transcriptional regulator SACOL0084 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL0084 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002390_01444.