CAZyme Information: MGYG000002390_01466

Basic Information

• Species: Ligilactobacillus agilis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus agilis
• CAZyme ID: MGYG000002390_01466
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		87539	6.3559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002390	2133539	Isolate	not provided	not provided

• Gene Location: Start: 144979; End: 147309 Strand: +

Full Sequence      

MTRTWHAKWIQPQQSDNYEEPVLSLAEMFAGKLPAQLPVTQRLRPVQHLKKCFELEAKPL
KRAQLFITAHGLYQAKLNGKNVTTALLTPEFTSYHHYLQYQEYDVTNLLEGENTLTILLA
DGWYAGRVSVNGGSNQFGNKLQLLAELIITYTDGTKQIIGSDESFVAKASYYDYSDLFIG
ECQDLRRKAESWLVNQDVKGCLPVEVVAGVFDSLQLQMGPQVQAKEKMEAKKIWREADGI
IVDFGQVLVGVVELDVKLAFGQKITLEHSEALDENGKFFHNIMGRNKDQTDVFIGRGSRD
KLRPTFTCHGFRYVKISGLTEMLTANEICAWVIASDLKTTGHLKTDNDLINKLINNIYWS
QKGNMVSIPTDCPQRERMGWTGDMQVFAPTASFFMDSYDFIRRWLISVRAEQTQAGEILD
FSPAPKDVFETPSLTGSFSSAGWGDAIIMVPWTLYQRYGKREVLEENYQAMLKWHDYAVK
SAKGDKADDRQYLWDTKFHYGDWMFPSYMIGATALGPMATAHATKDIFGTAFLAHSSELL
AQIADLLGDTSRRDELRAYFAKVKQAFNKYYFKEDKMTADFQGCYVIGLAFNLFDSSNKI
AAIKRLTELIVANDYRLDTGFLSVPYLLDVLIDNGQDDLASKLLLQDQCPSWLYEVKQGA
TTIWESWAGIEPNGKVGSYSFNHYAFGCVGDFLVRRIAGLQVLTPGYEKFLIAPKTNLGI
SEFNLSYESRFGTIKVLKAKTQLVVEVPQGTSALLKLAQVSEQPLELSAGKHVFKL

Enzyme Prediction     

No EC number prediction in MGYG000002390_01466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	237	757	2.5e-144	0.9880952380952381
CBM67	45	192	2.1e-20	0.7784090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.84e-108	338	697	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.90e-45	58	226	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.12e-23	241	333	9	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.48e-05	699	757	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA53194.1	1.63e-285	5	774	16	777
QQD65407.1	2.55e-282	4	747	7	742
SQG79958.1	3.61e-280	4	760	7	756
AQP42651.1	3.61e-280	4	760	7	756
QFQ91657.1	7.00e-279	3	765	8	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.03e-126	9	753	268	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.31e-118	26	774	114	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	4.74e-88	5	714	145	851	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	8.44e-126	9	753	268	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.15e-113	5	767	149	888	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.69e-96	5	776	146	910	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.72e-61	58	765	195	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002390_01466.