CAZyme Information: MGYG000002414_02277

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_02277
• CAZy Family: GH74
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1319		138672.17	5.8771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 2628093; End: 2632052 Strand: +

Full Sequence      

MIRNRIRKTGLLVLLGAMVGSLFSAFPATTHAASSEPYTWKSVVTGAGGGFVPGIIFNQT
EPNLIYARTDIGGAYRWNQATSSWVSISDSVGWVDWNKNGVDALATDPIDPNKVYMATGT
YTNHWDNNGQIMRSNDRGNTWQTTPLPFKVGGNMPGRSAGERLVIDPNKNNILYFGARSG
NGLWKSIDSGVTWSKVTSFPNVGTYIQNPTLDYGNDLVGLSWITFDKSTGTLGNATQTIY
VGVADTASSVYRSTDGGVTWTALAGQPTGFLPHHGELSSTGDLYITYSNGVGPYDGSKGE
VWKYNKTSGAWTNISPTTGTDNWYGFGGLALDAQHPNTLMVSSLNAWWPDEVIFRSTNGG
ATWSRIWDWGNYPERTYKFSMDITAAPWLDHGTTSTSLDPSPKLGWMMGDLEIDPFNSNR
MMYGTGATIYGSNNLTSWDTGGKVNISVMAKGVEETAVLGLISPPTGTSHLITALGDVSG
FRHEDLSVAPTKFQTSPSWATTMSIDYAELSPSYMVRVGSADKEKTPSMKSIGISNDGGV
NWYMPNSEPSNGTKTTVGHGQVAVSASGNSILWSTSDIGVYYSKTSGNSWTASAGLPAGA
KIASDRVNPNKYYGFYAGTFYVSVDGGATFTATAASGFPTNNVAGLQPNEAQISMKAVPG
IEGDIWFAGGNTVENKYGLWHSTNSGASFTKLTNVEEADLIGYGKAAPGQAYMALYTVAK
IDGVRGVFRSDDVGATWVRINDDAHQYAKINMAITGDPRIYGRVYLGTNGRGTLYADPVN
PPATGSTITPITASFDKKTANQADVAVTMTLNGNTLSTIKNGTATLVSGTDYTVSGSTVT
IKKAYLATQAVGTTTLTFSFSAGATQSLAVAVTDTTTPVSNSTITPTSAGFDKKTANQAD
VAVTMTLNGNTLSTIKNGTATLVVGTDYTVSGSTVTIKKAYLATQAVGTTTLTFGFSAGA
TQSLAVAVTDTTTPVSNSTITPTNAGFDKKTANQADVAVTMTLNGNTLSAIKNGTATLVA
GTDYTVSGSTVTIKKAYLATQAVGTTTLTFSFSAGATQSLAVAVTDTTTPVSNSTITPTN
AGFDKKTANQADVAVTMTLNGNTLSAIKNGTATLVAGTDYTVSGSTVTLKKEYLATQAVG
TTTLTFEFSAGAAQSLVVTVSDTSVAPTAALKVQMYNGTVTASGNTLNPKFKLVNTSTSA
VALSDVKLRYYYTIDGEKAQSFFCDWSQAGSANVTGTFVKLPTAKADADYYLELGFSSAA
GSLAAGASIDIQVRVAKEDWSNYTQTGDYSFNAVDTNFVDWTKAPAYISGNLIWGSEPN

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM3	1174	1255	1.5e-26	0.9886363636363636
GH74	89	202	4.2e-23	0.47639484978540775
CBM46	987	1059	1.2e-17	0.8850574712643678
CBM46	1083	1153	1.2e-17	0.8620689655172413
CBM46	797	867	1.3e-17	0.8620689655172413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03442	CBM_X2	3.71e-33	980	1062	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.
pfam03442	CBM_X2	5.52e-33	1076	1158	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.
pfam03442	CBM_X2	1.19e-32	788	870	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.
pfam03442	CBM_X2	9.61e-32	884	966	1	83	Carbohydrate binding domain X2. This domain binds to cellulose and to bacterial cell walls. It is found in glycosyl hydrolases and in scaffolding proteins of cellulosomes (multiprotein glycosyl hydrolase complexes). In the cellulosome it may aid cellulose degradation by anchoring the cellulosome to the bacterial cell wall and by binding it to its substrate. This domain has an Ig-like fold.
pfam00942	CBM_3	3.00e-26	1173	1254	1	82	Cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV33160.1	0.0	1	1319	1	1319
AIQ73809.1	0.0	1	1319	1	1223
AIQ29245.1	0.0	1	1319	1	1222
AIQ58082.1	0.0	1	1319	1	1222
AIQ41034.1	0.0	1	1319	1	1223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGL_A	0.0	35	779	3	747	Crystalstructure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, D60A mutant in complex with XXLG and XGXXLG xyloglucan [Paenibacillus odorifer]
6MGJ_A	0.0	35	779	3	747	Crystalstructure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_E Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_F Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_G Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGJ_H Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, apoenzyme [Paenibacillus odorifer],6MGK_A Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_B Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_C Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer],6MGK_D Crystal structure of the catalytic domain from GH74 enzyme PoGH74 from Paenibacillus odorifer, in complex with XLX xyloglucan [Paenibacillus odorifer]
6P2N_A	0.0	33	779	1	748	Crystalstructure of Paenibacillus graminis GH74 (PgGH74) [Paenibacillus graminis]
2CN3_A	3.06e-292	29	780	2	733	ChainA, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus],2CN3_B Chain B, BETA-1,4-XYLOGLUCAN HYDROLASE [Acetivibrio thermocellus]
4LGN_A	2.70e-288	33	783	2	740	Thestructure of Acidothermus cellulolyticus family 74 glycoside hydrolase [Acidothermus cellulolyticus 11B]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MUH7	0.0	17	1318	17	1027	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
A3DFA0	1.06e-291	29	780	29	760	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xghA PE=3 SV=1
Q70DK5	4.22e-291	29	780	29	760	Xyloglucanase Xgh74A OS=Acetivibrio thermocellus OX=1515 GN=xghA PE=1 SV=1
Q7Z9M8	2.28e-196	38	785	21	752	Xyloglucanase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cel74a PE=1 SV=1
Q5BD38	1.81e-126	35	777	32	807	Oligoxyloglucan-reducing end-specific xyloglucanase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000311	0.998812	0.000212	0.000286	0.000188	0.000156

TMHMM  Annotations     

start	end
12	34