CAZyme Information: MGYG000002414_03771

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_03771
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521		56987.6	5.1415

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 4266670; End: 4268235 Strand: -

Full Sequence      

MLRTIEHMSLREKIGQMFVTGFPSTEITPELKEVIEHYKVGNIILFSHNIDNKYQLGELV
TELQQWYTTHTGIPGFITIDQEGGRVTRMPKDATNVAGAMAIASSGRPENAYAAGRMTAR
ELKALGINFNLAPVMDVNNNALNPVINVRSYGDSVATVSQYGIQMMKGLLDGGVMSSLKH
FPGHGDTNVDSHIGLPTIEKTLEELEQLELLPFKAAIEQGAQAIMSAHILFPKIEKSGVP
GTMSHTIITEILKGKLGYKGLVVSDCLEMDAIKRYYGTAKGALGAVKAGIDLVFISHTPE
TVKEAIHLIEEAVATGDLDEALIDAAVTKILAYKAQYATIEELDYELVGCDVHRRANELM
RTETICLIKGELQPIHTGDEQVLFMGSYSYRTDLASSSLNQALSFPQYMGEHFNTAYEII
DIDPSEEQINAALPKVQGYKHIVIGLFNARENKGQLALVQKLLAAGCKVTAITLGRPYDL
PLIEGEFCGIAAFEYTLDAFKSLLPILNGEVVPTAKITIQM

Enzyme Prediction     

No EC number prediction in MGYG000002414_03771.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	294	2e-60	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	5.05e-95	8	388	1	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.26e-83	9	331	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.80e-44	24	306	10	290	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.12e-14	5	334	42	353	beta-glucosidase BglX.
pfam00458	WHEP-TRS	0.002	308	345	1	47	WHEP-TRS domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV34485.1	0.0	1	521	1	521
AIQ24820.1	0.0	2	521	1	520
AIQ36596.1	0.0	2	521	1	520
QCT00951.1	8.01e-309	2	521	1	520
QAY66997.1	5.88e-214	8	521	4	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	5.77e-100	8	511	11	521	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	2.28e-88	9	521	8	527	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	4.79e-71	5	371	39	441	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.50e-70	5	371	13	415	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.85e-70	5	371	43	445	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	2.62e-70	5	371	39	441	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	5.00e-58	25	498	49	563	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B2FPW9	1.03e-39	17	310	1	291	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
Q5H1Q0	1.94e-39	17	310	1	291	Beta-hexosaminidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) OX=291331 GN=nagZ PE=3 SV=2
A9M1Z4	3.54e-39	27	304	20	297	Beta-hexosaminidase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_03771.