CAZyme Information: MGYG000002421_00951

Basic Information

• Species: CABMKH01 sp902386935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Tissierellaceae; CABMKH01; CABMKH01 sp902386935
• CAZyme ID: MGYG000002421_00951
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000002421_4|CGC2	43888.94	9.4911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002421	2734249	Isolate	not provided	not provided

• Gene Location: Start: 298821; End: 299984 Strand: +

Full Sequence      

MNRHYISIKKLVFSMVICILVLGVSSVTPKAGDMDQNVKSKTVGYYTSWSSYSGFTPDKI
DPNKLTHINYAFANIDKELKVVLGDTEIDSQNIAGLKKLKEKNPNLKLLISVGGWTWSDK
FSDAALTHASRTRFANSCVEFIKTYGFDGVDLDWEYPVSGGLKTNKYRKEDKENFTLLLK
TIRERFNEESKKDGKEYILSIAGGAGAGYIQNVELDKLHKYIDFANIMTYDIHGPWDKHA
DFVAPLYTDESSNNMKASVDSGIKAWIKAGFPKEKLVVGIPFYGYEYHISQRTNNGLYQK
HTKAFSISYNDINSKYLNKNGYRRYYSSKSMVPWLYNGTSFISYEDGQSIGEKAKYIKSN
KLGGAMIWELGQDLNGQLLDKLYKGLK

Enzyme Prediction     

EC	3.2.1.14	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	40	377	1.7e-88	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	1.86e-135	43	373	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	2.16e-124	41	373	1	334	Glyco_18 domain.
COG3325	ChiA	3.19e-110	19	386	10	436	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	7.46e-105	41	373	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	8.12e-105	43	370	2	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI73896.1	1.36e-154	41	387	17	364
SET91583.1	4.28e-151	41	387	108	455
BCN31451.1	3.10e-149	22	387	31	387
QRV20034.1	1.29e-147	41	387	139	486
ADL05833.1	1.29e-147	41	387	139	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	3.54e-103	41	382	13	415	ChainA, Glycosyl Hydrolase [Niallia circulans]
6KST_A	4.45e-95	41	380	8	364	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	2.52e-94	41	380	8	364	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	5.69e-93	41	380	8	364	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6BT9_A	2.79e-83	34	386	30	470	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	4.11e-99	41	382	45	447	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9D7Q1	3.86e-60	40	373	22	361	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
Q13231	1.12e-59	40	373	22	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q6RY07	7.94e-57	43	381	25	374	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
Q95M17	1.52e-56	43	373	25	365	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.309790	0.667249	0.021315	0.000387	0.000380	0.000857

TMHMM  Annotations     

start	end
12	29