CAZyme Information: MGYG000002428_00304

Basic Information

• Species: Campylobacter_A concisus_W
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_W
• CAZyme ID: MGYG000002428_00304
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		39857.12	8.1492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002428	1937734	Isolate	South Africa	Africa

• Gene Location: Start: 35044; End: 36105 Strand: +

Full Sequence      

MKILVIKFRNIGDVLLTTPLIENLHHYYPDATIDFALNKGTEAMIEGNPYINKIHIYDRQ
SANSGFLKKLITEIKFIKAIKKEKYDMAVQTTTGDRGIIISKYAKIKKIVGFLGKNQSIN
TLLNVKAKYYENFSHTIDHNLNALRALGFEPVSKKVSVFSDESVEHLNLPKRFVHMHLTS
RWMFKCANDESMAELIDYCENELGVKVVLTSDNKENELEKLASVLKICKSEPINLGGKLN
LKQTIALSKHSSLFIGVDTAIMHIAAANDVPVIAFFGPSNAYEWGPWDNSLMENGYTAQN
GIQSMGKHIVYQKDWDFVPCDKEGIARHGVEKTLMDFSDEMPNIKAKIKEILG

Enzyme Prediction     

No EC number prediction in MGYG000002428_00304.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	74	292	1.1e-46	0.8577777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.86e-60	2	290	1	236	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02201	heptsyl_trn_III	1.43e-55	2	289	1	299	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0859	RfaF	1.12e-51	1	289	2	290	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK10422	PRK10422	1.35e-48	2	289	7	301	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	6.64e-29	75	295	3	228	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH86811.1	8.71e-258	1	353	1	353
QPI03480.1	3.97e-254	1	353	1	353
QPH88531.1	3.97e-254	1	353	1	353
QPH85045.1	1.14e-253	1	353	1	353
QPI01709.1	1.89e-252	1	353	1	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	5.43e-12	2	287	10	298	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	4.19e-06	1	280	1	283	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	4.19e-06	1	280	1	283	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	4.30e-06	1	280	1	283	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	9.94e-32	12	293	5	293	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	7.61e-30	12	293	5	293	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P45042	1.04e-06	1	353	1	345	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P26469	2.96e-06	1	300	1	303	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P24173	5.31e-06	1	313	1	315	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002428_00304.