CAZyme Information: MGYG000002455_00685

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00685
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000002455_2|CGC7	36800.54	4.6384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 398422; End: 399402 Strand: +

Full Sequence      

MNIWKSLLAVCLLIAMFGCGASASKKANQEGAAKQLPRLCVTGTQLMNEQGDTVVLKGVS
YGWHQFWPRFYNASTVDYLSGDWGAEVLRASMGVDLDSACYVYKPEFGINCVTTVVDAAI
ENHVYAIIDWHSHNLRQEEAKEFFAQMATRYKGVPNVIYEVFNEPVEDSWEQVKAYSVEI
IKTIRTIEPEAVILVGCPHWDQDIHLAADDPITGYNNIMYTVHFYANTHGQWLRDRTDYA
LGKGLPVFISECAGMEASGDGAVNKEEWQNWLDWMQQRSISWVAWSVSDKNETCSMLLPS
ASSGGNWADQDMKEWGQIVRDELQKK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	283	7.9e-94	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.33e-55	47	291	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	6.20e-06	112	288	118	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd06329	PBP1_SBP-like	9.43e-05	72	195	201	314	periplasmic substrate-binding domain of active transport proteins (substrate binding proteins or SBPs). Periplasmic substrate-binding domain of active transport proteins found in bacteria and Archaea. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89667.1	3.11e-251	1	326	1	326
ALJ59275.1	6.48e-244	1	326	1	326
QUU00598.1	2.35e-202	2	325	3	323
QUT65069.1	7.52e-202	2	323	3	321
SIP56247.1	7.52e-202	2	323	3	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.98e-79	38	325	12	302	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	1.22e-77	38	323	11	302	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	1.01e-76	38	323	11	303	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
5IHS_A	2.44e-74	12	326	9	323	Structureof CHU_2103 from Cytophaga hutchinsonii [Cytophaga hutchinsonii ATCC 33406]
3PZT_A	2.70e-74	38	323	36	324	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	4.69e-74	6	323	6	329	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	1.31e-73	6	323	6	329	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P06565	7.76e-73	12	325	13	328	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
O85465	2.40e-72	12	325	13	328	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P23549	1.12e-71	6	323	6	329	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000069	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24