CAZyme Information: MGYG000002473_00595

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_00595
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		78171.58	5.4468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 25016; End: 27097 Strand: -

Full Sequence      

MMNYIGGAGNSFCRKSFSIDRTVAEAILTVAADPHTYLWPSWMEVEHEHNWLLAGSFLKY
RVFLNSAPAAVGPFRPVRDGRAVAERYDVTGLLRQGENVLAVQSRGEKYGFALTLELTFS
DGSRQTVATGPGWKRQNANDFCNPVCWWHPALGMSRGTFGPGEQPEHLDGTRLPQNWERP
GFDDSGWEAAAVTAVDPFELEAGEALHYTPVSIAPIRIEQLGDGRIVADFGRAVAGGIEL
TSPCGAEIELRLGEELLPSGGVRFQMRTGNCYQEGWRFPENGGTLSHFGMRSFRYAELLG
YPDRLDPAAIRAVSITLPFREEDSAFSCSDPRLEQVWELCRNSIRYTTLDIYYDCPSRER
MAYEADAYINMLTHFAVEHQTATARRTILYQMNHYTWPCEWRMFMIPVVYEYYMHTGDLG
LVREVWPRLKSECTFHHLLKDGLVEKFPMRVIVDWPMSCRDEYEFGPAEAVPNAFLYRDL
CDQSKLAAALGLAGEAREYEELAVRVKRAFNTRLYDPESGLFLDNAASRHAGFHANMFAL
AFGVADDDKVERPLAFIAQSGMKCSVYGAQFYLEALFRYGCAEKAVELMTSDSDRSWLEM
IRLGATCATEAWNPELKPNMSFVHPWGSAPGNMIMRGVFGLRPTKPGWEEFECKPQPGGL
KSGRYRIRVPSGIITAEFDHENGELVTRCTRDK

Enzyme Prediction     

No EC number prediction in MGYG000002473_00595.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	218	688	1.6e-107	0.9722222222222222
CBM67	51	194	1.2e-23	0.7727272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.43e-45	321	638	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.66e-16	85	220	44	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.87e-06	220	315	2	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	7.70e-04	404	524	88	220	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17390	Bac_rhamnosid_C	0.006	640	690	1	52	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45611.1	0.0	2	690	1	691
BCJ57454.1	3.43e-128	60	687	376	1002
AVT31770.1	2.41e-125	60	683	399	1021
AVT37927.1	1.28e-124	60	683	399	1021
AXG58640.1	1.74e-115	77	690	385	1004

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.54e-26	215	681	183	679	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	2.91e-80	293	680	700	1114	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
P9WF03	2.67e-28	12	678	172	855	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_00595.