CAZyme Information: MGYG000002473_00879

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_00879
• CAZy Family: GH42
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
694	MGYG000002473_17|CGC1	78310.4	5.6669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 29561; End: 31645 Strand: +

Full Sequence      

MNFGVQYYRAPFPDAKHWESDFKKIRESGFNTVQLWISWGWVEATPDRFVYDDYDRLVEL
AAKHRLGVVLSTIAEIQPNWIHRLVPGSEMVDNFGHKVVSSARGEHHFGITPGGCTDHPG
VWERMARFIETTGRRYAGLDHLRGWDIWNELRWNVNADALVCFCPHTLAAYRCWLEKRFG
SLEGLNEAWKRRYACWEDVMPGKLPDRPYTELMSFQHFLTCRADEHAHRRYGVMRAVDPV
HLITAHGACPSALYSGDPGTYPVDRGNDWFLADALDGIGCSSFPQWFDVDDADFGLRIDM
VKSAARGRKVWLSELQGGRAAVGFNTYGVVRAAQQQRWLWNGLGCGADTILFWCWRDEVF
GRESAGFGISGRDGCAEERLAATRVTGELWERYAELFDHYVPDRAEVGLLFSPQSYYLGW
AQEGSGDRIRDGLAGYGRALTRSSIPLLFVEEEHLDALDGLKVLFLPRVLVTDPVTETAL
IRFVERGGTLVCESECGAFDSAGFYRYPEERFLARFGIVETGRRNLEAEAVDFQYNGRSY
RLGVEQWMTPPEKEPEGQLCRTVSYGAGRVVYLGSYPGNACGRSWNPEFEALLRDIVTDS
GVVPPVVVREPLPGKERFVYLKSGRSQGKSLLFVFFPPDVQEAEIAVGPELFPGNRAREL
FSGSETELAAGGDGRTMRLKPGRFQLAVYTDALV

Enzyme Prediction     

No EC number prediction in MGYG000002473_00879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	7	384	9.8e-66	0.9730458221024259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	2.74e-32	18	364	12	346	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	2.44e-19	4	547	19	547	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
cd03143	A4_beta-galactosidase_middle_domain	1.35e-06	407	561	1	146	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
pfam08532	Glyco_hydro_42M	4.16e-06	405	492	1	89	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF92860.1	4.72e-243	1	691	1	705
AHF93313.1	3.33e-237	1	692	1	787
AHF93732.1	5.73e-228	1	662	1	724
ADB53485.1	6.88e-162	1	679	1	700
QJU55110.1	5.40e-159	1	666	1	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LVW_A	3.74e-26	1	388	1	385	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
1KWG_A	3.02e-25	4	389	3	387	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
6Y2K_A	4.20e-16	1	386	1	383	ChainA, beta-galactosidase [Marinomonas sp. ef1]
3TTS_A	5.25e-12	14	491	21	483	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
5GSL_A	1.76e-06	5	243	27	280	Glycosidehydrolase A [Pyrococcus horikoshii OT3],5GSL_B Glycoside hydrolase A [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D9SM34	1.10e-28	1	497	1	479	Beta-galactosidase BgaA OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=bgaA PE=1 SV=1
B9LW38	2.05e-25	1	388	1	385	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
O69315	1.65e-24	4	389	3	387	Beta-galactosidase OS=Thermus thermophilus OX=274 PE=1 SV=1
O54315	1.59e-23	4	373	3	370	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1
Q8GEA9	2.79e-23	4	423	3	413	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_00879.