CAZyme Information: MGYG000002473_02649

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_02649
• CAZy Family: GH110
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		86995.26	8.3075

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 8081; End: 10423 Strand: -

Full Sequence      

MKQMMIYSALAVAAALPAATPAVFDFEQGLGKERFDRRYAGIETAAPLSGSRSLAVDTRT
SDSEWNGVWSLPKGVLKPGRSYKISLTAKVTDKANDRASLLFLIRPLSANHELSDAGMLT
PQTVGKEEKITFRLNVPEKPDDYSLQVHTHFGVRALVDDITVTPIELKEIPAPRQAKAVP
LPAVLPTGSEEFTVDRPKKESRKEFNAKEFGVSTASKDNTAALQRAIDTVRRQAPARLFL
EPGVYRFEGEKPLIFNALTDFELDGQGAELRFHRTGGDRQLIAVSNSTRLELKNFTVDWD
WERDPLASVVTVDSVAPDRRSIRLRFVDYEKFPNTDLRVADLSRIDPANRQADPVRPVRI
TLEMNKGQNRPEARFLEPNLVELTSRPGMFKSAMPGETFLMRHYGYDFGAFFLRNNQHLT
LENVTVASAPGMGVITSGRQHHWQLLNCRIAPPAGSKRPCSTTADAMHTISSAGFFRLEN
CELAYSCDDTMNFHDLNGYAVKLDENRIMTTNLNSHPGDYFRVGDPIELCNDDFSPTGFT
GKITAIKFRNRREGEITFDKPVPEPAGGGFVLFNRSYGSRNLIFRNNHIHHFPRGLLLMA
ENVTIENNRFEEGNAAGIKLETGYTFDVWSEGYGVRNVVIRNNRFTGVNRRGRYVSENRP
DIYINSYLRSDPSLLKSPYPVIRDIWITGNEFRESTGSPVFVSTADNVTISGNRFVNHET
VPVKEEKRGLIGAGNSGTVRVLNNVWESSLPGLKSGVLYDPDSVTKLEEGGNVVRSAAGK

Enzyme Prediction     

No EC number prediction in MGYG000002473_02649.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	208	741	6.4e-57	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	8.75e-10	577	745	29	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	4.55e-09	577	745	6	133	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	6.28e-09	577	720	47	154	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	1.85e-07	492	665	17	154	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam12708	Pectate_lyase_3	2.20e-05	205	298	2	108	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44429.1	1.68e-148	53	776	49	769
AVM44109.1	2.93e-142	53	776	90	806
AVM44539.1	3.09e-119	32	779	32	765
AVM46987.1	1.14e-115	50	772	16	742
QGQ98096.1	8.79e-105	21	776	837	1587

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1KD83	1.12e-19	201	725	29	561	Alpha-1,3-galactosidase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=glaA PE=3 SV=1
B2UNU8	2.56e-15	206	719	220	744	Alpha-1,3-galactosidase B OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=glaB PE=3 SV=1
A6LFT2	3.44e-15	205	722	26	569	Alpha-1,3-galactosidase B OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=glaB PE=3 SV=1
A6KWM0	1.24e-10	258	645	101	495	Alpha-1,3-galactosidase B OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=glaB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000381	0.998822	0.000198	0.000223	0.000197	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_02649.