CAZyme Information: MGYG000002474_03332

Basic Information

• Species: Rahnella variigena
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Rahnella; Rahnella variigena
• CAZyme ID: MGYG000002474_03332
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42685	7.4326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002474	3995023	Isolate	Australia	Oceania

• Gene Location: Start: 18824; End: 19972 Strand: -

Full Sequence      

MQKPVLTIGLVAGETSGDILGAGLIRALKKHHPDARFVGVAGPLMQAEGCEAWYEMEELA
VMGVVEVLERLPRLLKIRKDLTQRFSELRPDVFVGIDAPDFNITLEGRLKQRGIRTIHYV
SPSVWAWRQKRVFKIGKATDLVLAFLPFEKAFYDKFDVPCRFIGHTMADAMPLHPDKQAA
RLALGIPEDVHCLALLPGSRHAEVEMLSADFLKTSLQLRQTYPDLHIVVPLVNAKRREQF
ERIKAEIAPDLPAYLLDGKGREAMIASDAALLASGTAALECMLAKCPMVVGYRMKPFTFW
LAERLVKTPYVSLPNLLARREIVTELLQTECVPEKLSAALLPLLAGGEKSYALRETFLEL
HESIRRDADEQAAQAVMELANR

Enzyme Prediction     

No EC number prediction in MGYG000002474_03332.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	365	1.5e-137	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	379	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	6	382	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	6	382	2	377	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	3.58e-175	8	376	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.44e-52	10	327	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEX50839.1	9.27e-270	1	382	1	382
AZP45432.1	2.66e-269	1	382	1	382
QBJ10629.1	2.66e-269	1	382	1	382
AYA05853.1	2.66e-269	1	382	1	382
AZP49801.1	2.66e-269	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.10e-221	2	380	4	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.03e-221	2	380	4	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZH55	1.32e-227	6	382	18	394	Lipid-A-disaccharide synthase OS=Yersinia pestis OX=632 GN=lpxB PE=3 SV=1
Q667K2	1.32e-227	6	382	18	394	Lipid-A-disaccharide synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=lpxB PE=3 SV=1
A8GID3	3.45e-227	1	380	1	380	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
Q3Z5H6	6.95e-227	2	380	4	381	Lipid-A-disaccharide synthase OS=Shigella sonnei (strain Ss046) OX=300269 GN=lpxB PE=3 SV=1
C4ZRS4	6.95e-227	2	380	4	381	Lipid-A-disaccharide synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002474_03332.