CAZyme Information: MGYG000002480_01946

Basic Information

• Species: Adlercreutzia celatus_A
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Adlercreutzia; Adlercreutzia celatus_A
• CAZyme ID: MGYG000002480_01946
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		49594.34	7.8314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002480	2680191	Isolate	Canada	North America

• Gene Location: Start: 14534; End: 15862 Strand: -

Full Sequence      

MFDTVASQVSALSFVDIFNFCVFLTFTICYTYQLFYVLVVLTRRAPKKMARANHRYAVMV
AARNEETVIADLIHSIKVQNYPAELIDIFVIADNCTDNTADVAREAGAIVFPRSNDKLVG
KGYALDYGLKAIWEQYADRDYEAFFVFDADNVLDVNYFREMNATFDNGAKASTSYRNSKN
FGSNWISAGYGVWFLREAKFLNQARLTLNTSCAVSGTGFFIAADILKAAGGWKWHLLTED
IEFSAASIIDGVRISYCPTAVLYDEQPITFRDSWNQRFRWAKGFYQVFAHYAGGLVKGTL
TNPAGYRFACYDMLMTIAPGMLLSIISILFNTIIIVLAATGVMSTGVAIASSVTSVVFCL
CNYIVFMFVFGVLTTFVEWDSIRTTTAKKIRYMFTFPFFMLTYIPIALIALVKKAAWKPI
RHSISVDVAEFSEAEGVRLSSK

Enzyme Prediction     

No EC number prediction in MGYG000002480_01946.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	55	281	6.8e-29	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.39e-82	58	243	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	6.95e-38	13	417	13	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	3.19e-33	58	240	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	1.52e-26	55	283	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06427	CESA_like_2	8.25e-15	55	289	2	235	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA88856.1	0.0	1	442	1	442
BAN76823.1	5.73e-317	1	442	1	442
BCS57026.1	9.03e-312	1	442	1	442
BAK44311.1	3.12e-250	1	438	1	435
ACV55180.1	1.07e-246	1	434	1	431

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	4.90e-16	59	307	113	355	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P96587	6.74e-16	55	283	50	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q3MB01	1.51e-14	43	319	95	369	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	2.01e-14	57	319	109	369	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42
283	305
320	342
355	377
390	412