CAZyme Information: MGYG000002517_02101

Basic Information

• Species: Roseburia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia hominis
• CAZyme ID: MGYG000002517_02101
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		49243.52	4.9858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002517	3592125	Isolate	United Kingdom	Europe

• Gene Location: Start: 2313897; End: 2315201 Strand: +

Full Sequence      

MRLPEHFLIGAATAAHQVEGNNIRSDLWAMEHMKHTSFLEPSLDAVDHYHRYEEDIKLLS
DAGLNAYRFSIEWARIEPEEGVFDAGAVAYYHDVIACCKKYGVEPFVTLHHFSSPKWLMT
KGGWEASTTPADFARYVHYIMEELGSELHYVCTINEANMGIQVAAIAERYKRQMMAQMQA
AQTAPRSGDSADGTVQVGINLEKMMENQKATALENMEVFGVEKVENFTSMRTREGDLLIM
KAHELARKEIKALYPDIKVGLTLSLHDIQPQAGGEARAASEWDEEFLHYLPYIKEDDFLG
VQNYTRSLIGPDGQLPNPEGAELTQMNYEFYPEALEHVLRRVAEDFHGDLYVTENGIATS
DDTRRVAFIDAALNGVAACIRDGLPVKSYFHWSLLDNFEWQKGYSMTFGLIAVDRSTQTR
HPKESLRFLGSWNR

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	429	1.3e-114	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03356	BGL	1.80e-90	4	425	1	422	beta-galactosidase.
COG2723	BglB	2.26e-85	1	425	2	442	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	4.35e-79	2	431	4	446	Glycosyl hydrolase family 1.
PRK13511	PRK13511	4.36e-61	2	425	4	455	6-phospho-beta-galactosidase; Provisional
PLN02998	PLN02998	1.35e-39	3	432	31	484	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97245.1	0.0	1	434	1	434
AXB29242.1	8.11e-216	7	432	8	430
CBL02685.1	1.55e-213	7	432	8	430
QPK81646.1	1.64e-211	7	432	8	426
QTE67958.1	9.32e-203	1	433	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	1.33e-119	4	434	8	410	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	2.46e-103	7	430	36	425	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	1.46e-62	1	425	9	437	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	1.16e-57	1	430	3	400	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
1NP2_A	1.20e-46	5	425	6	418	Crystalstructure of thermostable beta-glycosidase from thermophilic eubacterium Thermus nonproteolyticus HG102 [Thermus nonproteolyticus],1NP2_B Crystal structure of thermostable beta-glycosidase from thermophilic eubacterium Thermus nonproteolyticus HG102 [Thermus nonproteolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03506	1.21e-45	4	425	7	435	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
P12614	3.87e-44	2	432	10	441	Beta-glucosidase OS=Agrobacterium sp. (strain ATCC 21400) OX=74562 GN=abg PE=3 SV=1
Q08638	4.21e-44	2	425	5	431	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
B3W7I3	9.79e-44	2	431	4	465	6-phospho-beta-galactosidase OS=Lacticaseibacillus casei (strain BL23) OX=543734 GN=lacG PE=3 SV=1
B9K7M5	1.09e-43	2	425	3	429	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.963145	0.036652	0.000091	0.000060	0.000032	0.000048

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002517_02101.