CAZyme Information: MGYG000002519_01741

Basic Information

• Species: Enterobacter asburiae_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter asburiae_B
• CAZyme ID: MGYG000002519_01741
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000002519_16|CGC5	43826.99	6.0894

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002519	4770654	Isolate	France	Europe

• Gene Location: Start: 140879; End: 142021 Strand: -

Full Sequence      

MMKVWPVKHSPLLRQPERFIARDELKSLIQKVTHSLVNIHDKTGEFLLRLDDGRVIDTKG
WAGWEWTHGVGLYGIWQYYCQTGDEGMRDIIDSWFADRFAEGATTKNVNTMSPFLTLAYR
YEETKNQAWRPWLESWAEWAMAEMPRTEHGGMQHITLAEENHQQMWDDTLMMTVLPLAKI
GKLLNKPEYVEETVYQFLLHVQNLMDRETGLWFHGWSYDGNHNFARARWARGNSWLTIAI
PDFLELVDLPENSAVRRYLVQVLNAQIAALAKYQDDSGLWHTLLDDPHSYLEASATAGFA
YGILKAVRKRYVGAEYAGVAEKAIRGIVKNISPEGELLQTSFGTGMGSDLEFYRQIPLTS
MPYGQAMAILCLTEYLRKYF

Enzyme Prediction     

No EC number prediction in MGYG000002519_01741.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	61	377	1e-116	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.41e-140	30	380	2	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.01e-125	38	379	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYD29119.1	2.01e-290	2	380	1	379
QBB07960.1	2.01e-290	2	380	1	379
ALL19835.1	1.16e-289	2	380	1	379
QYH18852.1	1.16e-289	2	380	1	379
AOL12338.1	9.92e-289	1	380	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.40e-244	4	380	5	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.97e-242	3	380	5	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.02e-155	24	379	7	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	2.17e-19	186	358	222	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.64e-47	64	377	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	1.85e-10	181	325	10	160	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.85e-10	181	325	10	160	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	8.39e-09	166	337	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002519_01741.