CAZyme Information: MGYG000002520_04542

Basic Information

• Species: Pluralibacter gergoviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pluralibacter; Pluralibacter gergoviae
• CAZyme ID: MGYG000002520_04542
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		81580.7	10.0062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002520	5408082	Isolate	United States	North America

• Gene Location: Start: 4928168; End: 4930426 Strand: -

Full Sequence      

MSVLLLAVADRLWPLPLHEVAPARVVVAEDGAPLWRFADADGIWRYPVTINEVSPRYLEA
LIQYEDRWFWDHPGVNPLSVARAAWQDLRAGRVISGGSTLTMQVARLLDPHPRTFGGKLR
QLWRALQLEWHLDKRQILTLYLNRAPFGGTLQGIGAASWAYLGKPPAELSYAEAALLAVL
PQAPSRLRPDRWPQRAQAARDKVLSRMQARGVWPARAVKEAKEEPVWLFPRQMPQLAPLF
ARRVLAASREEKIVTTLDAGLQRQLEEMALNWKSRLPPRSSLAILVVDHTSMKVRGWVGS
ADLADDSRFGHVDMVTAVRSPGSLLKPFIYGLAMDDGLIHPASLLQDVPRRFSDYRPGNF
DSGFHGPVSMSDALQRSLNLPAVQVLEAYGPKQFAARLRNAGLPLSLPAGAEPNLSLSLG
GAGARLADIVAAYSALARHGRAGRLRLLPGDPLVERPLLSPGAAWIIRRILAGEDQPLPD
SALPQVVPLATKTGTSYGYRDAWAVGVNARYVIGIWTGRPDGTPVVGQFGFISAVPLLNQ
VSNLTLSRATGGLPADPRPASVSGGTVCWPGGQSLPAGDGNCRRRLSGWLLDNSQPPTLL
LPGQEGMRGIRFPIWVNAAGERVAADCPGAQEQMLSVWPLPLEPWLPAGERRAARIPAAS
GTCPPLGAQDPAPLTLAGVRDGAVIRRLPGENRASLVLQTSGGEGRRWWFVNGEPQQAEG
PALTLELQQAGEYQLVVMDDGGQTAAARFTLQ

Enzyme Prediction     

No EC number prediction in MGYG000002520_04542.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	44	208	4.5e-52	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4953	PbpC	0.0	2	752	14	732	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
TIGR02073	PBP_1c	0.0	14	749	1	724	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK11240	PRK11240	0.0	4	752	21	772	penicillin-binding protein 1C; Provisional
TIGR02074	PBP_1a_fam	1.39e-109	45	518	2	500	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.48e-106	45	562	76	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVR05427.1	0.0	1	752	20	771
AIR00377.1	0.0	1	752	20	771
ADO47497.1	0.0	9	752	28	774
QKN80893.1	0.0	9	752	28	774
ALR77674.1	0.0	9	752	28	774

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	1.67e-38	26	537	23	714	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2OQO_A	2.02e-33	45	221	20	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	6.98e-33	45	221	20	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	3.02e-32	58	524	169	673	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	3.24e-32	58	524	190	694	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	0.0	9	752	28	770	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P38050	6.41e-48	45	518	67	569	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q9KUC0	2.76e-44	58	524	193	694	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
O66874	5.98e-40	45	518	63	639	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q00573	5.89e-38	38	534	64	616	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999962	0.000090	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002520_04542.