CAZyme Information: MGYG000002532_00173

Basic Information

• Species: Enterovibrio hollisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Enterovibrio; Enterovibrio hollisae
• CAZyme ID: MGYG000002532_00173
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	MGYG000002532_1|CGC2	92534.26	4.8971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002532	4096279	Isolate	not provided	not provided

• Gene Location: Start: 175576; End: 178017 Strand: +

Full Sequence      

MTQILLNGEWRLTSLTDGEISVPIQIPGDIHSALLAAGRIPDPYYGCNESLVQWVSEHDW
QLETSFNLAAGSLEVSGVDLILSMVDTVASVAVNGEVVLLCSNMFREYRTDIRHHLHEGI
NTLTVTLKRADLEAKARAGRLPFPVPWAEGNNQIPHMNTLRKTQCHAGWDWGICLLASGI
YDSVRLQPVNQVRLNHIRTSQQWHSNGQCDLAVSVDCSSLTPNAVNAVCELISPSGERWT
QFLDVTRGTTACTFSISDPECWWPAGYGNQPLYTLIVSVDGQQISKRIGLRELHLDTTQD
EAGSAMTFMVNGKAIMAKGANWIPLDAMPGKQTPVRYRRLLEDAKAANMNMIRVWGGGMY
ERDCFYELCDELGLMVWQDLMFACALYPSTPSFIKDVEQEVVYQVRRLSDHPSLALWCGD
NEVIGAIGWYPESKSNREKYVVNYDRLNRVLQDVVEREDPSRRFWASSPCNGELDFGDAW
HDDNKGDMHFWDVWHSGQSFDAYHNIKPRFCSEFGYQSWPSLPTVKTFAAQEDWNVTSPT
FEQHQKNGRGNSIITEMFTRYFRFPKNFAQMLYLSQVQQALAIKTASEYWRANKPVCRGI
LYWQLNDCWPVSSWSSIEYTGRWKQLHYHAKRFFAPQAAVFVEEDNALNLHLINDEHRRC
EVNGQVTWYDWLGEVIDTWPVEACLGEDDNQMVWQCDRNMINERQHKGFFHVEIDVEGTR
FANTWFDDIYKRLPLPKADITVDVAECDGSLLVTLTSDLPAFFVHLEYEGEGRFSDSSFT
LMPCSPVTVSYIGSADIDALNAGLHVYQLAGSY

Enzyme Prediction     

No EC number prediction in MGYG000002532_00173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	659	6.5e-93	0.6382978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.74e-128	6	811	15	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	4.21e-13	737	810	1	77	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	2.93e-10	178	422	195	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.12e-07	192	291	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	0.002	648	718	3	75	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMG29943.1	0.0	1	813	1	813
AWK83312.1	0.0	1	813	1	832
QSH58570.1	0.0	1	813	1	832
ARR51293.1	0.0	1	813	1	832
QAY36926.1	0.0	1	813	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	6.13e-155	1	812	3	853	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	6.30e-155	1	812	3	853	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	4.51e-154	1	812	1	851	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	4.63e-154	1	812	3	853	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	6.64e-141	4	783	9	808	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4FZV0	1.03e-127	6	782	25	849	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q95327	1.38e-127	1	813	20	879	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	2.71e-127	1	813	20	879	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q8K2I4	4.26e-125	6	782	25	847	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
O00462	2.43e-123	6	813	25	879	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002532_00173.