CAZyme Information: MGYG000002534_05468

Basic Information

• Species: Citrobacter_A farmeri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A farmeri
• CAZyme ID: MGYG000002534_05468
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
161		18154.84	9.8849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002534	5715629	Isolate	Australia	Oceania

• Gene Location: Start: 27727; End: 28212 Strand: -

Full Sequence      

MKGVAFGIILSLIPLSSMAADCFDMAGRDYKIDPDLLRAISWQESRFKIDAIGRNPVTGY
GSGLMQIDSQHFNELSRYGIKPDHLLSDACLNIYTGAYYLAQAFKKWGVSWDAVGAYNAG
FKKTPRQAARRYEYAKKIHYYYTAIKASKRTSSKDQKIAMN

Enzyme Prediction     

No EC number prediction in MGYG000002534_05468.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	33	150	1.6e-19	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13722	PRK13722	6.77e-75	1	149	1	149	lytic transglycosylase; Provisional
cd13400	LT_IagB-like	1.63e-46	30	143	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	1.50e-36	5	161	4	159	type III secretion system invasion protein IagB.
pfam01464	SLT	2.32e-21	23	139	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	6.34e-15	26	149	146	275	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG02256.1	1.01e-115	1	161	1	161
QGV85602.1	1.01e-115	1	161	1	161
AVU38178.1	1.01e-115	1	161	1	161
QJS00729.1	1.01e-115	1	161	1	161
AHI61570.1	1.01e-115	1	161	1	161

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	3.92e-18	21	105	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14499	4.36e-74	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	8.78e-74	1	149	1	149	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1
P17738	2.51e-73	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
Q00739	2.06e-72	1	149	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P43018	4.58e-27	6	161	5	159	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002406	0.988468	0.007988	0.000406	0.000334	0.000340

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002534_05468.