CAZyme Information: MGYG000002536_00439

Basic Information

• Species: Plesiomonas shigelloides
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Plesiomonas; Plesiomonas shigelloides
• CAZyme ID: MGYG000002536_00439
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		43297.7	8.4884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002536	3653255	Isolate	not provided	not provided

• Gene Location: Start: 110468; End: 111640 Strand: +

Full Sequence      

MQPEQTSLPVTQPLVIGIVAGETSGDILGAGLIRALRAQHPDARFVGIAGPRMQAEGCES
WFDMEELAVMGLVEVLKHLPRLLTIRRTLVQNFTRLKPDVFIGIDAPDFNIGLELKLKQH
GIKTVHYVSPSVWAWRQNRVFKIAKATDLVLAFLPFEKAFYDRFNVPCRFVGHTMADSMP
LEADKAGARRTLGLSEDASVLAVLPGSRAGEVAMLAEPFLQTAQRLQQQRPELQILVPMV
NARRREQFLALKAEIAPDLRITLLDGQARDAMTAADATLLASGTAALECMLAKSPMVVAY
RVKPLTYWLAKKLVKTEFVSLPNLLAGKKIVPELIQEDCTVERLTAKLSMLLSQDNRCLK
RMFTELHQKIRCDADQQAAAAVLDLIQRDD

Enzyme Prediction     

No EC number prediction in MGYG000002536_00439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	16	371	1.6e-143	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	0.0	13	372	1	364	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	13	388	1	377	lipid-A-disaccharide synthase; Reviewed
TIGR00215	lpxB	2.33e-175	16	372	8	371	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam02684	LpxB	1.75e-169	16	372	1	364	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.86e-55	18	351	231	569	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ88268.1	6.57e-274	1	390	1	390
QOH79255.1	1.33e-273	1	390	1	390
QWK94058.1	1.33e-273	1	390	1	390
SBT61941.1	2.68e-273	1	390	1	390
QWK96638.1	8.94e-272	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.52e-173	12	387	5	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.06e-172	12	387	5	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6D8D0	4.65e-183	11	386	3	380	Lipid-A-disaccharide synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=lpxB PE=3 SV=1
C6DAJ6	2.67e-182	11	386	3	380	Lipid-A-disaccharide synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=lpxB PE=3 SV=1
A8GID3	5.20e-182	12	385	4	379	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
B7NIE4	4.92e-180	12	387	5	382	Lipid-A-disaccharide synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=lpxB PE=3 SV=1
B7UJ83	1.41e-179	12	387	5	382	Lipid-A-disaccharide synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002536_00439.