CAZyme Information: MGYG000002560_01497

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_01497
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43026.18	5.354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 60676; End: 61809 Strand: +

Full Sequence      

MKAFLSILTLTLLLMMPVGLWGTERQAFSSDMQKTMAQVAKWQINNFTYQEKGNLHDYGI
DAWTNAVLYAGMLKWAQMADSSSTYFDWLMKIGEENKWSVPANFADYPKYQYYHADELAI
GQFYLGMYDHYKKENMIHAVQERLDWIMAHPADTCMTHSNKQCWTWCDALFMAPPVYAHL
AKITGDSRYLEFMHDNFLRTYCYLYDSSNCLFFRDDSYFNKLEANGQKVFWGRGNGWVLA
GIANILDLLPGDSGLKPFYEQLFVELAIRLSGLQDKDGFWHASLLDPDSYPSPETSSTAL
ITYGLAYGLNHHLLDASYLPIVQKAWKALVSIVDEDGKVGWVQPIGADPKKVTREMTAVY
GVGAFLMAGTEIMKLSE

Enzyme Prediction     

No EC number prediction in MGYG000002560_01497.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	374	1.3e-85	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.33e-86	38	375	4	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.56e-50	63	376	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK60570.1	1.39e-159	23	375	31	383
QIK55141.1	1.39e-159	23	375	31	383
QIU93494.1	1.07e-123	14	377	13	372
QDO70899.1	1.38e-123	18	377	13	369
QDO67620.1	1.52e-123	8	375	7	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	7.60e-72	24	375	20	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.04e-51	23	377	24	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.61e-43	159	377	134	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	5.07e-71	24	375	27	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	2.71e-67	5	377	6	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	4.70e-64	26	373	51	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	3.57e-10	134	342	103	299	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000676	0.998399	0.000345	0.000194	0.000175	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_01497.