CAZyme Information: MGYG000002563_00574

Basic Information

• Species: Romboutsia timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Romboutsia; Romboutsia timonensis
• CAZyme ID: MGYG000002563_00574
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
183		21327.81	9.5114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002563	2922672	MAG	China	Asia

• Gene Location: Start: 26850; End: 27401 Strand: +

Full Sequence      

MAKKKIFFVLAIIIILFTSLLIEKDTINKILYPRRYSEYVEIYSKEFGLDENLVYSVIKV
ESKFRKDAVSHKGAKGLMQISDITREWAKEEMNLGDIDIFDPKTNIKIGCWYLNKLYKEF
GRLDLVIAAYNGGSGNVNKWLSDYSYSKDGKSLDLIPFEETSMYVKKVTKNYKMYNKLYS
KEG

Enzyme Prediction     

No EC number prediction in MGYG000002563_00574.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	177	1.8e-31	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.20e-73	33	174	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.45e-49	31	178	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.46e-39	51	173	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.06e-37	32	181	135	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	2.71e-32	38	173	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED93144.1	1.49e-121	1	183	1	183
CEI72025.1	2.72e-88	1	183	1	184
AXU49364.1	6.60e-84	1	183	1	182
AWH80563.1	6.60e-84	1	183	1	182
AWH76797.1	6.60e-84	1	183	1	182

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	5.70e-13	32	168	449	591	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	7.74e-13	32	168	449	591	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6CF8_A	8.56e-12	16	178	331	499	Crystalstructure of Cj0843 lytic transglycosylase of Campylobacter jejuni at 1.87A resolution [Campylobacter jejuni]
6CF9_A	8.56e-12	16	178	331	499	Crystalstructure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni at 2.3A resolution in I23 space group [Campylobacter jejuni],6CFC_A Crystal structure of soluble lytic transglycosylase Cj0843 of Campylobacter jejuni in complex with Bulgecin A [Campylobacter jejuni]
7LAM_A	8.64e-12	16	178	351	519	ChainA, Lytic transglycosylase domain-containing protein [Campylobacter jejuni],7LAQ_A Chain A, Lytic transglycosylase domain-containing protein [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.85e-16	46	172	70	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	5.03e-13	32	168	476	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	3.15e-12	32	168	476	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.15e-12	32	168	476	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
A9MQR3	1.34e-10	35	143	192	313	Membrane-bound lytic murein transglycosylase C OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.692741	0.288371	0.016556	0.000445	0.000370	0.001518

TMHMM  Annotations     

start	end
5	22