CAZyme Information: MGYG000002582_00652

Basic Information

• Species: Succinivibrio sp900552905
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp900552905
• CAZyme ID: MGYG000002582_00652
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000002582_11|CGC1	37324.55	8.6586

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002582	1765105	MAG	China	Asia

• Gene Location: Start: 18608; End: 19651 Strand: +

Full Sequence      

MAGGTGGHVFPALAIAERLRKDGHEVLWLGTRGRMEEQLVPKYGFPLEFIDVKGIRRNGL
AAKLKAPFMVLKAIFEALAIIKRFKPDVALGMGGYASGPGGVAAFLKGIPVVLHEQNAAA
GLTNRLLFKISKVVMLGFPGAFVGSKVKVVGNPIREDIMALHNAPRDFNHDKLKIAIVGG
SLGAQALNELVPQALKLCKNQNLEVCHQCGKGHLERVQQAYAEANFSYAVSEFVTDMQAL
YATHDLIVCRAGALTVAETAAAGIPAIFVPLPSAVDDHQTKNARFMEKCQACMVCPQKDL
SAESLANIIDNLNYDRQKLASMSQNAYAHAVLNAAEVAQDILINVCK

Enzyme Prediction     

No EC number prediction in MGYG000002582_00652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	175	330	1e-53	0.9617834394904459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	3.68e-164	1	342	7	352	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	2.07e-147	1	336	5	345	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	1.67e-137	1	342	6	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	1.44e-130	1	345	6	354	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam03033	Glyco_transf_28	5.42e-47	1	135	4	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ92154.1	8.84e-121	1	347	8	352
QUM79055.1	2.44e-117	1	336	8	342
ATG75217.1	8.20e-117	1	347	10	357
CED62062.1	1.16e-116	1	336	13	347
AVP92846.1	1.33e-116	1	340	8	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	1.14e-96	1	342	15	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.26e-95	1	336	12	344	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	6.10e-91	1	347	8	356	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4LA25	1.77e-121	1	347	8	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=murG PE=3 SV=1
A4SI56	5.34e-117	1	340	8	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=murG PE=3 SV=1
Q0HE83	1.27e-115	1	343	11	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella sp. (strain MR-4) OX=60480 GN=murG PE=3 SV=1
A0KPX2	1.74e-115	1	340	8	347	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=murG PE=3 SV=1
Q0HZR6	2.55e-115	1	343	11	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Shewanella sp. (strain MR-7) OX=60481 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002582_00652.