CAZyme Information: MGYG000002603_00722

Basic Information

• Species: Prevotella sp900767615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900767615
• CAZyme ID: MGYG000002603_00722
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		46219.91	9.3741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002603	2739364	MAG	China	Asia

• Gene Location: Start: 51801; End: 53006 Strand: +

Full Sequence      

MRKILMMLAAAALALPLSAAQPAKKTAKVKKQNKKEVKASKKWDHEQVVALITKVNNYWQ
ANNKPEVRAFWDNAAYHTGNMEVYKMLKDQKMLDYSIRWAEHNDWSGATEANPAKWKYKP
YGEGKQHVLFGDWQICFQTYIDLYNIEAAKGNAAASEYMVKRAKEVMHYEAYSQPTDYWW
WSDALYMVMPVMTKMYKLTGDTKYLDKLYDNLLTTDEIMLDKETNLYFRDGKYVYPKHKS
ANGKKDFWARGDGWVLAGLAKVLQDMPKDYKHYQFFVDKFQKLAKAVAEIQQPEGYWTRS
MMDPEHAPGPETSGTAFFTYGMLWGVNNGYLNKKEYKKVIDRAWTYLTETAVQADGKVGY
VQPIGERAIPGQTVDANSQANFGVGAMLLTACEYDKYLNSK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	395	1.5e-79	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.92e-84	52	398	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.16e-39	53	362	18	314	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79822.1	1.92e-202	40	399	18	370
ADE82673.1	1.57e-201	40	398	18	369
AGB28481.1	9.70e-191	40	398	19	378
BCS84432.1	4.36e-187	48	398	10	363
QQY40390.1	8.61e-178	36	400	20	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	6.61e-169	47	400	32	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	8.98e-147	46	398	14	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	4.45e-55	71	393	53	365	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	6.21e-13	178	356	138	322	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.53e-12	178	356	128	312	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.90e-54	71	393	60	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	3.31e-52	173	393	151	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.03e-44	179	393	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	3.40e-12	178	356	138	322	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.009188	0.982059	0.007905	0.000339	0.000253	0.000223

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002603_00722.