CAZyme Information: MGYG000002616_01635

Basic Information

• Species: CAG-495 sp001917125
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp001917125
• CAZyme ID: MGYG000002616_01635
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688		78288.92	9.9832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002616	1919079	MAG	China	Asia

• Gene Location: Start: 4419; End: 6485 Strand: +

Full Sequence      

MRESGFDNIYNLNSKRIRNRRIKVFGLMFLSTLLATAKWVTVIPTDSTVFTKILMVSLFI
LTFAWIALFFWSSVFGFFELLAKRKVPGIVWVPESTPLKSRTAILMPVYNESPQSVFANL
LAMANDLKKTGQARAFDIFVVSDTTNPKVWVEEEKTWLEAQKYMPDEIKLYYRRRVKNTA
RKSGNIEDFCNKWGAAYASMIVLDADSLMNGSTMLRMAQLMDANPKAGIIQAPPMTVNKN
SLFARMQQFAGKVYGPIVSAGLAYWQVGDSNYWGHNAIIRVSAFIQCCGLPVLPGKAPFG
GHILSHDFVEAALIRRGGWSAWLLPELKGSYEECPPTMIDFAGRDRRWCQGNMQHIKIMI
SKGLHPVSRIHFTIGIMSYLSSPIWLCFLLVGLAIALGREFFPPVYFPEVRTLFPTWPIF
DKIGTIALFVISMFMLIFPKFLGLIIYLLQNRRHGRQSPDLTRGAVKSVLLEIVVSALQA
PIMMMFQSKFVFEIFTGHAVSWNTQNRDDEGTSFRDAFSRHIWHTLLGIVTTIVVGLYAQ
PLFWWMLPITTGLMLSIPISMFTSREKAGLWFKKHNYFLIPEETKIPHIIRAAKKYKEAL
VKTKEKSYGADLIIRDSVLNALHILMLPINGPAPDYRREDLEKAQVKIENYINHGIEPDL
SKDEEIALLYAPEILSKARTAWSLNHQA

Enzyme Prediction     

No EC number prediction in MGYG000002616_01635.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	20	687	64	734	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	20	578	41	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	1.54e-155	102	355	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
COG1215	BcsA	5.83e-13	55	442	9	371	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.06e-12	104	289	1	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO00644.1	7.36e-208	20	683	14	671
ADO71363.1	1.14e-202	20	680	14	668
QPM81905.1	3.74e-196	20	679	14	668
ABF89910.1	3.74e-196	20	679	14	668
QVW71154.1	3.74e-196	20	679	14	668

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5F1Q0	6.49e-170	58	627	93	655	Glucans biosynthesis glucosyltransferase H OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=opgH PE=3 SV=1
Q9KSG9	6.49e-170	58	627	93	655	Glucans biosynthesis glucosyltransferase H OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=opgH PE=3 SV=1
A0KWF0	3.11e-166	54	627	90	657	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain ANA-3) OX=94122 GN=opgH PE=3 SV=1
Q0HJ63	8.75e-166	54	627	90	657	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-4) OX=60480 GN=opgH PE=3 SV=1
Q0HUS0	8.75e-166	54	627	90	657	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-7) OX=60481 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43
53	75
376	398
426	448
522	544