CAZyme Information: MGYG000002629_00408

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QAND01; UMGS1975
• CAZyme ID: MGYG000002629_00408
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208	MGYG000002629_88|CGC1	24268.83	5.8806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002629	939337	MAG	China	Asia

• Gene Location: Start: 406; End: 1032 Strand: +

Full Sequence      

MTRTATAYPTRRSRQPARKRKQKKLWQLWVALGIAIIILALLALVGYPYVKKWAYPLEYE
DYIVQYSEENDLDPYLVCGVIHTESHFDVDAKSRVGAIGLMQIMPETGEWIAKKMPLENY
SEEKLKDPETNIKMGCWYLKYLLDKFDGDLTLVLAGYNAGPNRVAQWLDDEKYSEDGKLT
NIPYQETEDYVKKVQNAREVYKSYYTLE

Enzyme Prediction     

No EC number prediction in MGYG000002629_00408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	71	199	6.9e-32	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.21e-81	56	200	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.39e-63	54	202	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.85e-44	74	194	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.84e-37	54	205	134	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.51e-33	63	168	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT54455.1	7.34e-62	11	207	8	208
AYH39946.1	2.60e-59	30	207	22	196
APH13298.1	3.37e-56	34	205	7	179
ACQ54562.1	1.36e-55	34	205	7	179
AUN22945.1	1.36e-55	34	205	7	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	9.33e-24	51	194	404	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	9.39e-24	51	194	408	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	9.48e-24	51	194	414	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	9.53e-24	51	194	418	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	9.60e-24	51	194	424	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	1.89e-20	55	205	476	628	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.89e-20	55	205	476	628	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	2.57e-20	55	205	476	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	1.06e-19	67	197	68	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	5.62e-18	46	206	1409	1557	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999979	0.000061	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
28	50