CAZyme Information: MGYG000002641_00956

Basic Information

• Species: Faecalibacterium sp003449675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp003449675
• CAZyme ID: MGYG000002641_00956
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		90986.47	5.4656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002641	2686912	MAG	China	Asia

• Gene Location: Start: 154482; End: 156896 Strand: +

Full Sequence      

MELDQEKQNQEAAERCRALAQRIVRELAPRSVQVLEDSGLLEKAFCKMNTTVVQSAPELL
VVADPQWVSLPAVQAEKVLLVCAEYAGMADCAKQLVAQGFCRELAWKDHGKEQPTALFCR
MDAPELPELENGYEQQLDILRERTLLAERTAAEQTAQLERLRSDLSLSRSHERDLEKTLN
SVVNSTFWKASWPLRYLVSKCRQLWHTFPLFVFFATLRRVGFAGVKAQAKAKKEYKKLFP
GKTMPADRFADVELLVKQAADQPAAPLISIVVPLYNTPHDFLVELLDSVQNQTYRNWELC
MVDAGQDADVGALVQERASTDSRIRYRKLDSNEGIAGNTNQGFALATGEYIALLDHDDIL
HPCALWYVAEAIAKQGADFVYTDEVTFEGDIDHLTVYHFKPDYMLDNLRSNNYICHLSVF
SAALLAKVGGDERAEFNGSQDYDLYLRLTEQAEKIVHIPHLLYYWRSSPASVASNISAKT
YCLEAAMKALRAHYDRMGVPVDAVTMVPNTPGFYKTDYTITKPGRVSVLIPSCDHSGDLR
LCVESIYRKTTYPDFEIIIIENNSKEPATFRCYEQLQKEHPDTLHVLTWQGTGFNYSALN
NFGARAATGEYLLLLNNDTEVISPRWMEEMVMYAQQDRVGCVGAKLLYPDNTIQHAGIGF
GFLTLAAHMHKNFPVGHPGYMGRLSYAQDVYAVTAACLMVRKDVYEQVEGLDESFAVAFN
DVDFCVRVREAGYTNVFTPFAQLYHYESKSRGLDESPAKRKRFASEVERFQKRWAKQLAA
GDPCMNPNFDLMKEDFSFDIKPLE

Enzyme Prediction     

No EC number prediction in MGYG000002641_00956.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	269	409	2.5e-26	0.8470588235294118
GT2	523	750	1.3e-19	0.9347826086956522

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.28e-85	266	466	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	5.88e-41	528	747	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	8.69e-30	525	752	4	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.17e-27	269	466	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.54e-24	269	420	1	151	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL00720.1	0.0	1	804	1	804
AXB29591.1	0.0	1	804	1	804
ATO99477.1	0.0	1	804	1	809
QIA42131.1	0.0	1	804	1	809
ATL89683.1	0.0	1	804	1	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.60e-12	267	465	6	215	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.23e-127	266	796	366	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	7.06e-87	266	757	319	804	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	1.81e-13	267	408	4	144	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q58457	1.33e-11	266	466	8	212	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P77414	9.18e-11	266	469	5	218	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002641_00956.