CAZyme Information: MGYG000002646_00211

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella
• CAZyme ID: MGYG000002646_00211
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000002646_2|CGC1	42305.4	6.3717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002646	1639033	MAG	China	Asia

• Gene Location: Start: 64699; End: 65841 Strand: -

Full Sequence      

MKVMFSAGEASGDTHAASVANALKEIDPSVDMFGMGGTLMERAGVRIVYDIKNLGVIGIV
EIVKSLPKFFKLRTYLKRVMMKEKPDILVCVDYPGFNMKLAAVAHELGIPVLYYIAPTIW
AWHSSRGNTIRKYVTKVASIFPFEAEAYRKYKCDVDFVGHPLLDIVHPTMSKEAAEEYFG
ARKDAKKVLLMPGSRKQEVLSLLDTMLKSGEQLMANHEDIQFFLPRAHTIDRSELETFID
AHKVPVTITEDHTYDLMQICDVCLAASGTATLETAMMELPTILLYRVSPITYGIGKMVVN
VTHVGLPNIVAGKEVIPELLQDAVTPEAIVSLVEPLLTDVERNEAMRSELREVHHKLGEP
GAVKRVAELVYNLGKEKCNE

Enzyme Prediction     

No EC number prediction in MGYG000002646_00211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	358	3e-122	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.04e-141	1	373	2	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.46e-120	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.32e-93	3	359	1	363	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.15e-86	3	373	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.50e-53	1	373	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG93955.1	1.01e-272	1	380	1	380
BBU36764.1	4.58e-269	1	380	1	380
BBU34833.1	4.58e-269	1	380	1	380
CAB1276542.1	2.96e-265	1	380	1	380
SNU95574.1	5.98e-265	1	380	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.79e-59	1	357	7	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.37e-58	1	357	7	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	7.48e-100	2	376	8	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	5.45e-97	2	377	8	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	1.06e-96	3	376	6	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	3.39e-95	2	373	8	379	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q3A550	1.43e-93	2	376	9	384	Lipid-A-disaccharide synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002646_00211.