CAZyme Information: MGYG000002663_00107

Basic Information

• Species: Prevotella sp900772835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900772835
• CAZyme ID: MGYG000002663_00107
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000002663_2|CGC1	54131.24	8.1618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002663	2098573	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 45613; End: 47094 Strand: +

Full Sequence      

MKKLLTLAVALVCTALGAIAQDYPYSKLYENLPFKMDRVERPSFPDRTASVADFGAKGDG
TTLCTAAIQKAIDQTAQKGGGKVVVPQGVWFTGPIVLKSNINLHLEKGAILLFSPDYNLY
PIVETVFEGLDTRRCQSPISARGAHNVAITGEGVVDGNGQHWRPLKRDKVTESYWKEVTA
KGGAYIRDGFWIPTEGARKGYMMADMNVPTGNLTEAQWDSIKVFLRPVMVNLVSCKNVWL
NGVIFQNSPAWNLHPLMCENVLIEGVEVRNPSFAQNGDGLDLESCKNTLIVNSRFDVGDD
GICIKSGKDENGRKRGIPCQNVIVDGCTVFKGHGGFVVGSEMSGGVKNISVSNCQFLGTD
VGLRFKSKRGRGGIVENIWIKNISMFDIPTEAVIFNLYYGGMSAAEAKAAGKNKTEDVKP
MPVDETTPCFRNIYIEDIVCKNAHRAMFFNGLPEMPVENINLKNISITAEKPAEFKYCKG
IKQENVNVVINRQ

Enzyme Prediction     

No EC number prediction in MGYG000002663_00107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	74	483	1.3e-83	0.9692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.32e-102	5	459	32	468	Polygalacturonase [Carbohydrate transport and metabolism].
PLN02218	PLN02218	9.25e-19	48	489	67	421	polygalacturonase ADPG
PLN02793	PLN02793	8.11e-18	3	438	11	392	Probable polygalacturonase
pfam00295	Glyco_hydro_28	3.03e-17	227	394	85	245	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	3.15e-17	226	443	137	360	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37923.1	5.49e-258	21	490	22	491
QUT89608.1	4.84e-255	9	488	8	489
ALJ59331.1	7.13e-255	9	488	8	489
QUT73828.1	2.29e-249	1	488	1	488
QNT67369.1	3.35e-243	1	488	1	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	7.24e-81	36	486	15	429	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	4.27e-67	25	492	21	444	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	1.79e-38	41	469	149	568	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	1.84e-19	57	488	19	374	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	8.07e-17	44	157	17	121	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	4.86e-47	48	467	62	424	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	3.32e-40	47	466	150	566	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P27644	7.29e-38	230	456	25	249	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P18192	1.49e-20	57	476	45	396	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P26509	1.28e-18	57	488	45	400	Endo-polygalacturonase OS=Pectobacterium parmentieri OX=1905730 GN=pehA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999133	0.000164	0.000154	0.000145	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002663_00107.