CAZyme Information: MGYG000002672_01050

Basic Information

• Species: UMGS911 sp003343545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS911; UMGS911 sp003343545
• CAZyme ID: MGYG000002672_01050
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000002672_12|CGC1	63702.8	4.7446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002672	2438668	MAG	Canada	North America

• Gene Location: Start: 22932; End: 24653 Strand: -

Full Sequence      

MKKIGDINPCLKGYASDPRTRRYLSPVRIVRSYGNVSGTENLIGDKACQITLGGGEDVCT
LSNSKGCSERAGILLDYGTEISGSARIMVFGVSGRTGRADLHIKFGESVSEALSDLGEKN
SCCDHANRDEIINVGFLSANETNESGFRFVYLELIGEDVTVSLKAVQAVFIFRDLEYRGS
FECSDSLVNKIWQTAAYTAHLNMQEYLWDGIKRDRLVWIGDMQTEVMTIASVFGYSDIVP
RSMDLVRDETPVGTWMNGISSYSLWWIFLQYDFYMSYGDYPYLLKQREYMTSLLSLLCEY
VGDDGAEKLPESRFIDWPNSENEEAKHAGLQSMLLMAMERGAFICDILGEYDISDKCRKS
VENLSRHRPSAGGSKQAASLMVCAGLADAEKTNSEILSVGGARGFSTFLGYYTLSAIAKS
GDYDGAIEAMKQYWGGMLEMGATTFWEDFNIDWMENSGRIDEPVPEGKRDIHGDFGAYCY
LGFRHSLCHGWASGPVPYLAQTVLGVKVTSPGTRSIDIVPHLGSLEYVNGSYPTPHGDIC
ISHIRRDDGSIETKVELPPHWRKTGEFSYEYIG

Enzyme Prediction     

No EC number prediction in MGYG000002672_01050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	72	560	1.4e-91	0.9702380952380952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.76e-17	179	450	4	313	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.07e-04	505	559	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU04507.1	3.63e-202	18	558	27	565
AUD07449.1	7.51e-202	16	562	37	580
BBE16159.1	9.54e-201	21	558	40	577
QGQ98689.1	8.10e-198	11	558	4	551
ATP57578.1	7.43e-197	18	558	38	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.18e-49	70	555	191	685	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	2.01e-28	146	558	504	932	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.88e-13	20	501	51	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6GSZ_A	1.37e-06	74	279	329	544	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002672_01050.