CAZyme Information: MGYG000002681_01296

Basic Information

• Species: UMGS1975 sp900546685
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QAND01; UMGS1975; UMGS1975 sp900546685
• CAZyme ID: MGYG000002681_01296
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225	MGYG000002681_70|CGC1	26085.09	8.5153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002681	1889419	MAG	Canada	North America

• Gene Location: Start: 7387; End: 8064 Strand: +

Full Sequence      

MKKQGRCTTMLWGDYMANSKTTAYPARRARQAGRRKKQRNLWQLWIVLGLAIIILALLAL
VGYPYAKKLAYPLKYEAYITEYAEANGLDPYLVCGVIHTESHFDIEAESRVGAVGLMQIM
PDTGEWIAKKMSMKDYSEAKLKDPETNIRMGCWYLKYLMDRFDGDMTLVLAGYNAGPNRV
TQWLEDEKYSQDGKLTDIPYRETEEYVKKVENAKEMYRSYYTLES

Enzyme Prediction     

No EC number prediction in MGYG000002681_01296.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	88	216	7.1e-31	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.27e-80	72	216	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.51e-61	70	218	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.75e-42	90	210	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.12e-35	66	221	130	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.22e-31	79	195	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT54455.1	1.67e-62	16	223	1	208
AYH39946.1	7.16e-56	46	223	22	196
ACQ54562.1	1.41e-54	50	221	7	179
AUN22945.1	1.41e-54	50	221	7	179
APH21425.1	1.41e-54	50	221	7	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.67e-25	67	210	404	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.70e-25	67	210	408	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.74e-25	67	210	414	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.77e-25	67	210	418	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.81e-25	67	210	424	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	2.99e-20	71	210	476	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	3.45e-19	71	210	476	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	3.45e-19	71	210	476	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31608	1.69e-18	76	210	61	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	8.91e-18	62	210	1409	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999965	0.000059	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
44	66