CAZyme Information: MGYG000002685_01197

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA9506
• CAZyme ID: MGYG000002685_01197
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	MGYG000002685_125|CGC1	39760.57	4.6023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002685	3385444	MAG	Canada	North America

• Gene Location: Start: 8; End: 1054 Strand: +

Full Sequence      

MKPFFRLGSTIENFHFIKAYQIYPPKDFQKWAEICAGIIRHYNEGWADGFRLGIEHWEIW
NEPDNAVTIEENPMWKGSPEEFYEFYCTVSKYLKQQFPNIKVGGYGSCGFYAVSNADFSE
VARSTSRVEYFIEYLNGFLEYSRANGGILDFFSWHSYADVTDNVKYAEYARQKLDSFGYR
ETEIYLDEWNPGVEQKGLLRDAANIAAGMCLMQGTPTDMCMYYDAQITSELCGMFDFVAH
DVYKAYYAFYAFHKLYVLGREATSNSNMEGVYCCAATDGKSAGIIVVNRTAEEVKFNLVL
QGADVKDAVCYAVDEEHDFQKNRAAFSGAAMPANAIWYIHFSKTDGEA

Enzyme Prediction     

No EC number prediction in MGYG000002685_01197.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	1	317	4.2e-30	0.7703016241299304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	4.42e-13	1	192	91	274	Glycosyl hydrolases family 39.
cd21510	agarase_cat	8.37e-09	2	166	55	198	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM69820.1	5.18e-106	1	321	98	423
QJD85864.1	2.83e-48	2	348	96	456
QJD82796.1	1.05e-47	2	319	95	409
QTH43246.1	2.01e-47	2	341	95	438
QEL16017.1	5.64e-43	5	242	122	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z3K_A	1.84e-21	24	230	119	309	Crystalstructure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus],5Z3K_B Crystal structure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus]
1PX8_A	6.03e-09	24	109	123	202	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
6YYH_A	2.59e-08	24	157	146	253	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36906	3.30e-08	24	109	123	202	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	2.44e-07	24	109	123	202	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002685_01197.