CAZyme Information: MGYG000002687_01727

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000002687_01727
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000002687_84|CGC1	27208.24	10.0995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002687	2671909	MAG	Canada	North America

• Gene Location: Start: 6197; End: 6922 Strand: +

Full Sequence      

MSDVTLKIETGPTWKGILGQFLCFCARWILRGFFLFIGFYLASLWLPISVKAAEVTIPRA
AQQYRATLVRAAHATWGMDAPVSVFAAQVHTESWWRNDTVSHVGAQGLAQFMPATARWLP
SVAPETGKPEPFNPGWSLRALCTYDRWLWERVTGHSDMERMAFALSAYNGGLGWVNRDRK
KARALGVDDRRWFGAVENVNAGRGKAAFRENRNYPRLILKERQYAYIKAGWGPGVEDEAL
L

Enzyme Prediction     

No EC number prediction in MGYG000002687_01727.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.65e-22	86	213	16	137	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	2.25e-16	81	173	4	96	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	3.34e-15	85	223	4	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.47e-14	86	220	23	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.79e-12	92	219	31	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV72330.1	7.64e-125	49	239	9	199
SFV71937.1	6.65e-98	82	241	1	160
AAS95608.1	2.75e-80	41	238	21	216
ADP86211.1	2.75e-80	41	238	21	216
ADU63417.1	8.14e-80	42	235	7	199

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9CPJ2	1.07e-07	84	236	305	435	Membrane-bound lytic murein transglycosylase F OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltF PE=3 SV=2
P44587	2.58e-07	84	236	304	434	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mltF PE=3 SV=2
A5UG36	1.13e-06	84	236	304	434	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=mltF PE=3 SV=1
Q4QNV4	1.13e-06	84	236	304	434	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=mltF PE=3 SV=2
A6VMD7	2.04e-06	84	236	307	437	Membrane-bound lytic murein transglycosylase F OS=Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z) OX=339671 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.905804	0.093399	0.000375	0.000155	0.000090	0.000186

TMHMM  Annotations     

start	end
28	50