CAZyme Information: MGYG000002688_01343

Basic Information

• Species: Borkfalkia sp900557285
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia; Borkfalkia sp900557285
• CAZyme ID: MGYG000002688_01343
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		62502.6	7.9053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002688	1832213	MAG	Canada	North America

• Gene Location: Start: 273; End: 1922 Strand: +

Full Sequence      

MPAKAKKNIQAATGSETTEKRACESIPAAESARKKRTARKTAAKDTDPVPVNTSQTALSA
ALPEQDAAAPQITVVPKKKILFVASEATPFIATGGLAEVIGSLSKAIAVNEDFDVRVVIP
LYSDISWEYRNKFKYLGNIFVPLAWRNQYCGIFSYESNNVTFYFIDNEYYFKRPGCYGYY
DDGERFAFFCRSVMEIMPFLNFYPESMHCHDWQGALAAIYLKTIYCFRPEYQFIRSLFTI
HNIEYQGKYSLDILEDLFGISNTWKYLLEYNKCINLMKAAIECSEKFSTVSPHYAQEIKD
PYYAHGLEAIVRRNEFKLFGILNGIDTDSYNPATDKSVFANYSADNIEPKKKCKEELQKM
FNLPVKADTPIIAIISRLVSHKGLDLVRTVIEEVLRQDVQVIILGKGDSAYENYFSDLSR
RYVGKLVTVIAFNPDLSRKIYSGADLFLMPSKSEPCGLSQMIASRYGTVPIVRETGGLYD
SIKPVGSGGNGFTFANYNAYDMLYVIREAINCYYNKEFWPQLVKRVMSVDFSWQRSAKEY
EKIYGEMLK

Enzyme Prediction     

No EC number prediction in MGYG000002688_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	79	544	9.1e-167	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	79	548	2	479	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	79	544	2	470	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	79	549	2	465	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	79	544	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14098	PRK14098	3.36e-99	79	548	7	487	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1243454.1	6.39e-175	79	549	2	473
BCI60006.1	9.05e-175	79	547	2	472
ASB40510.1	2.58e-174	79	549	2	474
QQR29794.1	2.58e-174	79	549	2	474
ANU52824.1	2.58e-174	79	549	2	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.76e-81	79	544	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.07e-81	79	544	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.35e-80	79	544	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	9.01e-78	78	544	125	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNE_A	1.82e-72	80	544	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J4I4	7.88e-155	79	548	2	475	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1
A4IS20	1.21e-152	79	549	2	476	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	4.86e-152	79	549	2	476	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
Q97GX6	1.37e-149	79	548	2	477	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
Q6HC18	1.88e-149	80	549	3	476	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002688_01343.